BLASTX nr result
ID: Ophiopogon24_contig00014139
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00014139 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241282.1| synaptonemal complex protein 1 isoform X4 [A... 80 5e-15 ref|XP_020241281.1| myosin-2 heavy chain isoform X3 [Asparagus o... 80 5e-15 ref|XP_020241280.1| myosin-2 heavy chain isoform X2 [Asparagus o... 80 5e-15 ref|XP_020241278.1| myosin-2 heavy chain isoform X1 [Asparagus o... 80 5e-15 ref|XP_020094393.1| coiled-coil domain-containing protein 18 iso... 65 9e-10 gb|OAY79540.1| hypothetical protein ACMD2_17747 [Ananas comosus] 65 9e-10 ref|XP_020094385.1| coiled-coil domain-containing protein 18 iso... 65 9e-10 ref|XP_020094419.1| coiled-coil domain-containing protein 18 iso... 65 9e-10 ref|XP_020094376.1| coiled-coil domain-containing protein 18 iso... 65 9e-10 ref|XP_020094367.1| coiled-coil domain-containing protein 18 iso... 65 9e-10 ref|XP_020094358.1| coiled-coil domain-containing protein 18 iso... 65 9e-10 gb|OAY67239.1| hypothetical protein ACMD2_19030 [Ananas comosus] 65 9e-10 ref|XP_021304120.1| myosin heavy chain, muscle isoform X3 [Sorgh... 64 4e-09 ref|XP_021304115.1| myosin heavy chain, muscle isoform X2 [Sorgh... 64 4e-09 ref|XP_021304112.1| myosin heavy chain, muscle isoform X1 [Sorgh... 64 4e-09 ref|XP_021318538.1| uncharacterized protein LOC8073427 isoform X... 61 3e-08 ref|XP_021318537.1| uncharacterized protein LOC8073427 isoform X... 61 3e-08 ref|XP_021318536.1| myosin heavy chain, muscle isoform X4 [Sorgh... 61 3e-08 ref|XP_021318535.1| myosin heavy chain, muscle isoform X3 [Sorgh... 61 3e-08 ref|XP_021318534.1| WEB family protein At5g55860 isoform X2 [Sor... 61 3e-08 >ref|XP_020241282.1| synaptonemal complex protein 1 isoform X4 [Asparagus officinalis] Length = 632 Score = 80.5 bits (197), Expect = 5e-15 Identities = 42/62 (67%), Positives = 51/62 (82%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDSLARC 206 PVSW+ DAAVDAATYENL EPT +D+VDPVSSA LEMV LLILA+QL+Q++LA+ Sbjct: 576 PVSWSTDAAVDAATYENLYEPT------EDKVDPVSSAGLEMVALLILASQLLQENLAKS 629 Query: 205 ST 200 +T Sbjct: 630 TT 631 >ref|XP_020241281.1| myosin-2 heavy chain isoform X3 [Asparagus officinalis] Length = 653 Score = 80.5 bits (197), Expect = 5e-15 Identities = 42/62 (67%), Positives = 51/62 (82%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDSLARC 206 PVSW+ DAAVDAATYENL EPT +D+VDPVSSA LEMV LLILA+QL+Q++LA+ Sbjct: 597 PVSWSTDAAVDAATYENLYEPT------EDKVDPVSSAGLEMVALLILASQLLQENLAKS 650 Query: 205 ST 200 +T Sbjct: 651 TT 652 >ref|XP_020241280.1| myosin-2 heavy chain isoform X2 [Asparagus officinalis] Length = 673 Score = 80.5 bits (197), Expect = 5e-15 Identities = 42/62 (67%), Positives = 51/62 (82%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDSLARC 206 PVSW+ DAAVDAATYENL EPT +D+VDPVSSA LEMV LLILA+QL+Q++LA+ Sbjct: 617 PVSWSTDAAVDAATYENLYEPT------EDKVDPVSSAGLEMVALLILASQLLQENLAKS 670 Query: 205 ST 200 +T Sbjct: 671 TT 672 >ref|XP_020241278.1| myosin-2 heavy chain isoform X1 [Asparagus officinalis] ref|XP_020241279.1| myosin-2 heavy chain isoform X1 [Asparagus officinalis] gb|ONK59807.1| uncharacterized protein A4U43_C08F10910 [Asparagus officinalis] Length = 674 Score = 80.5 bits (197), Expect = 5e-15 Identities = 42/62 (67%), Positives = 51/62 (82%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDSLARC 206 PVSW+ DAAVDAATYENL EPT +D+VDPVSSA LEMV LLILA+QL+Q++LA+ Sbjct: 618 PVSWSTDAAVDAATYENLYEPT------EDKVDPVSSAGLEMVALLILASQLLQENLAKS 671 Query: 205 ST 200 +T Sbjct: 672 TT 673 >ref|XP_020094393.1| coiled-coil domain-containing protein 18 isoform X5 [Ananas comosus] ref|XP_020094397.1| coiled-coil domain-containing protein 18 isoform X5 [Ananas comosus] ref|XP_020094401.1| coiled-coil domain-containing protein 18 isoform X5 [Ananas comosus] ref|XP_020094410.1| coiled-coil domain-containing protein 18 isoform X5 [Ananas comosus] Length = 559 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/58 (58%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMK-DRVDPVSSAALEMVELLILATQLVQDSL 215 P+SWT DA+ DA TYE+L EPT S++ K ++ DP+SSA LEM+ELLILA +L+++SL Sbjct: 499 PISWTGDAS-DAITYESLYEPTDSSDSSKTEKADPMSSAGLEMLELLILAAELLKESL 555 >gb|OAY79540.1| hypothetical protein ACMD2_17747 [Ananas comosus] Length = 646 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/58 (58%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMK-DRVDPVSSAALEMVELLILATQLVQDSL 215 P+SWT DA+ DA TYE+L EPT S++ K ++ DP+SSA LEM+ELLILA +L+++SL Sbjct: 586 PISWTGDAS-DAITYESLYEPTDSSDSSKTEKADPMSSAGLEMLELLILAAELLKESL 642 >ref|XP_020094385.1| coiled-coil domain-containing protein 18 isoform X4 [Ananas comosus] Length = 659 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/58 (58%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMK-DRVDPVSSAALEMVELLILATQLVQDSL 215 P+SWT DA+ DA TYE+L EPT S++ K ++ DP+SSA LEM+ELLILA +L+++SL Sbjct: 599 PISWTGDAS-DAITYESLYEPTDSSDSSKTEKADPMSSAGLEMLELLILAAELLKESL 655 >ref|XP_020094419.1| coiled-coil domain-containing protein 18 isoform X6 [Ananas comosus] Length = 663 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/58 (58%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMK-DRVDPVSSAALEMVELLILATQLVQDSL 215 P+SWT DA+ DA TYE+L EPT S++ K ++ DP+SSA LEM+ELLILA +L+++SL Sbjct: 603 PISWTGDAS-DAITYESLYEPTDSSDSSKTEKADPMSSAGLEMLELLILAAELLKESL 659 >ref|XP_020094376.1| coiled-coil domain-containing protein 18 isoform X3 [Ananas comosus] Length = 666 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/58 (58%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMK-DRVDPVSSAALEMVELLILATQLVQDSL 215 P+SWT DA+ DA TYE+L EPT S++ K ++ DP+SSA LEM+ELLILA +L+++SL Sbjct: 606 PISWTGDAS-DAITYESLYEPTDSSDSSKTEKADPMSSAGLEMLELLILAAELLKESL 662 >ref|XP_020094367.1| coiled-coil domain-containing protein 18 isoform X2 [Ananas comosus] Length = 672 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/58 (58%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMK-DRVDPVSSAALEMVELLILATQLVQDSL 215 P+SWT DA+ DA TYE+L EPT S++ K ++ DP+SSA LEM+ELLILA +L+++SL Sbjct: 612 PISWTGDAS-DAITYESLYEPTDSSDSSKTEKADPMSSAGLEMLELLILAAELLKESL 668 >ref|XP_020094358.1| coiled-coil domain-containing protein 18 isoform X1 [Ananas comosus] Length = 675 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/58 (58%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMK-DRVDPVSSAALEMVELLILATQLVQDSL 215 P+SWT DA+ DA TYE+L EPT S++ K ++ DP+SSA LEM+ELLILA +L+++SL Sbjct: 615 PISWTGDAS-DAITYESLYEPTDSSDSSKTEKADPMSSAGLEMLELLILAAELLKESL 671 >gb|OAY67239.1| hypothetical protein ACMD2_19030 [Ananas comosus] Length = 688 Score = 65.5 bits (158), Expect = 9e-10 Identities = 34/58 (58%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMK-DRVDPVSSAALEMVELLILATQLVQDSL 215 P+SWT DA+ DA TYE+L EPT S++ K ++ DP+SSA LEM+ELLILA +L+++SL Sbjct: 628 PISWTGDAS-DAITYESLYEPTDSSDSSKTEKADPMSSAGLEMLELLILAAELLKESL 684 >ref|XP_021304120.1| myosin heavy chain, muscle isoform X3 [Sorghum bicolor] Length = 654 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/56 (53%), Positives = 44/56 (78%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDS 218 PVSW+ D++ DA TYE LCEP+ ++ +VDP+SSA +EMVELLILA +++++S Sbjct: 595 PVSWSGDSS-DAITYEALCEPSDSPKSKSGKVDPLSSAGMEMVELLILAAEILKES 649 >ref|XP_021304115.1| myosin heavy chain, muscle isoform X2 [Sorghum bicolor] gb|OQU92307.1| hypothetical protein SORBI_3001G326100 [Sorghum bicolor] Length = 681 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/56 (53%), Positives = 44/56 (78%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDS 218 PVSW+ D++ DA TYE LCEP+ ++ +VDP+SSA +EMVELLILA +++++S Sbjct: 622 PVSWSGDSS-DAITYEALCEPSDSPKSKSGKVDPLSSAGMEMVELLILAAEILKES 676 >ref|XP_021304112.1| myosin heavy chain, muscle isoform X1 [Sorghum bicolor] Length = 682 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/56 (53%), Positives = 44/56 (78%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDS 218 PVSW+ D++ DA TYE LCEP+ ++ +VDP+SSA +EMVELLILA +++++S Sbjct: 623 PVSWSGDSS-DAITYEALCEPSDSPKSKSGKVDPLSSAGMEMVELLILAAEILKES 677 >ref|XP_021318538.1| uncharacterized protein LOC8073427 isoform X6 [Sorghum bicolor] ref|XP_021318539.1| uncharacterized protein LOC8073427 isoform X6 [Sorghum bicolor] Length = 617 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/56 (51%), Positives = 44/56 (78%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDS 218 PVSW+ D++ DA TYE LC+P+ ++ +VDP+SSA +EMVELLILA +++++S Sbjct: 558 PVSWSGDSS-DAITYEALCDPSDSPKSKSWKVDPLSSAGMEMVELLILAAEILKES 612 >ref|XP_021318537.1| uncharacterized protein LOC8073427 isoform X5 [Sorghum bicolor] Length = 738 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/56 (51%), Positives = 44/56 (78%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDS 218 PVSW+ D++ DA TYE LC+P+ ++ +VDP+SSA +EMVELLILA +++++S Sbjct: 679 PVSWSGDSS-DAITYEALCDPSDSPKSKSWKVDPLSSAGMEMVELLILAAEILKES 733 >ref|XP_021318536.1| myosin heavy chain, muscle isoform X4 [Sorghum bicolor] gb|KXG26460.1| hypothetical protein SORBI_3006G105400 [Sorghum bicolor] Length = 763 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/56 (51%), Positives = 44/56 (78%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDS 218 PVSW+ D++ DA TYE LC+P+ ++ +VDP+SSA +EMVELLILA +++++S Sbjct: 704 PVSWSGDSS-DAITYEALCDPSDSPKSKSWKVDPLSSAGMEMVELLILAAEILKES 758 >ref|XP_021318535.1| myosin heavy chain, muscle isoform X3 [Sorghum bicolor] Length = 764 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/56 (51%), Positives = 44/56 (78%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDS 218 PVSW+ D++ DA TYE LC+P+ ++ +VDP+SSA +EMVELLILA +++++S Sbjct: 705 PVSWSGDSS-DAITYEALCDPSDSPKSKSWKVDPLSSAGMEMVELLILAAEILKES 759 >ref|XP_021318534.1| WEB family protein At5g55860 isoform X2 [Sorghum bicolor] Length = 765 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/56 (51%), Positives = 44/56 (78%) Frame = -3 Query: 385 PVSWTADAAVDAATYENLCEPTYPSEAMKDRVDPVSSAALEMVELLILATQLVQDS 218 PVSW+ D++ DA TYE LC+P+ ++ +VDP+SSA +EMVELLILA +++++S Sbjct: 706 PVSWSGDSS-DAITYEALCDPSDSPKSKSWKVDPLSSAGMEMVELLILAAEILKES 760