BLASTX nr result
ID: Ophiopogon24_contig00013455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00013455 (1189 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249335.1| CBS domain-containing protein CBSX5-like [As... 78 2e-12 ref|XP_020689884.1| CBS domain-containing protein CBSX5-like [De... 66 5e-08 ref|XP_020115113.1| CBS domain-containing protein CBSX5 [Ananas ... 64 1e-07 gb|OAY76369.1| CBS domain-containing protein CBSX5 [Ananas comosus] 64 1e-07 gb|ONK73745.1| uncharacterized protein A4U43_C04F34820 [Asparagu... 62 2e-07 ref|XP_011098329.2| CBS domain-containing protein CBSX5 [Sesamum... 64 2e-07 gb|PKA60414.1| CBS domain-containing protein CBSX5 [Apostasia sh... 63 3e-07 ref|XP_020263436.1| CBS domain-containing protein CBSX5-like [As... 63 3e-07 ref|XP_010241981.1| PREDICTED: CBS domain-containing protein CBS... 63 4e-07 ref|XP_011082650.1| CBS domain-containing protein CBSX5 [Sesamum... 63 5e-07 ref|XP_022874760.1| CBS domain-containing protein CBSX5-like [Ol... 63 5e-07 ref|XP_009382391.1| PREDICTED: CBS domain-containing protein CBS... 62 8e-07 emb|CBI25846.3| unnamed protein product, partial [Vitis vinifera] 58 1e-06 ref|XP_020675475.1| CBS domain-containing protein CBSX5-like [De... 62 1e-06 gb|PKU84055.1| CBS domain-containing protein CBSX5 [Dendrobium c... 62 1e-06 ref|XP_020585708.1| CBS domain-containing protein CBSX5-like [Ph... 60 3e-06 ref|XP_018851045.1| PREDICTED: CBS domain-containing protein CBS... 60 4e-06 gb|OVA00567.1| hypothetical protein BVC80_9087g64 [Macleaya cord... 59 4e-06 ref|XP_017232279.1| PREDICTED: CBS domain-containing protein CBS... 60 4e-06 gb|KVI10497.1| Cystathionine beta-synthase, core [Cynara cardunc... 60 5e-06 >ref|XP_020249335.1| CBS domain-containing protein CBSX5-like [Asparagus officinalis] Length = 270 Score = 77.8 bits (190), Expect = 2e-12 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = -2 Query: 672 IAGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRV 520 IAGKICMVDVLC LC+EGN+S AAALK+PVSALLAKGEG V+++E +S + Sbjct: 136 IAGKICMVDVLCFLCSEGNISNPAAALKNPVSALLAKGEGLVKRVEASSSI 186 >ref|XP_020689884.1| CBS domain-containing protein CBSX5-like [Dendrobium catenatum] gb|PKU86656.1| CBS domain-containing protein CBSX5 [Dendrobium catenatum] Length = 388 Score = 65.9 bits (159), Expect = 5e-08 Identities = 31/51 (60%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -2 Query: 669 AGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGS-VRKLETNSRV 520 AGK+CMVD+LC LCAE N+S+ AALK+P+SALL+KG + +R++E++SRV Sbjct: 60 AGKLCMVDILCYLCAEENISSPVAALKNPISALLSKGMAALMRRVESHSRV 110 >ref|XP_020115113.1| CBS domain-containing protein CBSX5 [Ananas comosus] Length = 396 Score = 64.3 bits (155), Expect = 1e-07 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -2 Query: 669 AGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNS 526 AGK+CMVDVLC LCAE N+++ AAAL PVSAL+ KG VR++E +S Sbjct: 57 AGKVCMVDVLCFLCAEDNIASPAAALDKPVSALIPKGPALVRRVEPHS 104 >gb|OAY76369.1| CBS domain-containing protein CBSX5 [Ananas comosus] Length = 396 Score = 64.3 bits (155), Expect = 1e-07 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = -2 Query: 669 AGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNS 526 AGK+CMVDVLC LCAE N+++ AAAL PVSAL+ KG VR++E +S Sbjct: 57 AGKVCMVDVLCFLCAEDNIASPAAALDKPVSALIPKGPALVRRVEPHS 104 >gb|ONK73745.1| uncharacterized protein A4U43_C04F34820 [Asparagus officinalis] Length = 199 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = -2 Query: 675 GIAGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRV 520 GI G ICMVDVLC LC++ N+ +AL++PVS LL+KG+G VR ++ +S + Sbjct: 59 GIVGDICMVDVLCYLCSQQNIKCPVSALQNPVSVLLSKGDGVVRAIDPDSSI 110 >ref|XP_011098329.2| CBS domain-containing protein CBSX5 [Sesamum indicum] Length = 394 Score = 63.9 bits (154), Expect = 2e-07 Identities = 45/113 (39%), Positives = 61/113 (53%) Frame = -2 Query: 666 GKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRVKLRTRSFLLNF 487 GKICMVDV+C LC E N+SA ALKSPVS LL +G VR LE +S S L Sbjct: 63 GKICMVDVICYLCREENLSAPGLALKSPVSVLLPSVKGLVRHLEPSS-------SLLEAI 115 Query: 486 KLESETACGKVAGKENTFLNVTSRKRSLRRGNCFPRFGGQPSAHFVNGQLICW 328 L + A V +++ ++ S++R L++ + P+ H NGQ CW Sbjct: 116 DLTLQGAQNLVVPIKSSTTSI-SKRRQLQKSSA----SISPTIH--NGQEFCW 161 >gb|PKA60414.1| CBS domain-containing protein CBSX5 [Apostasia shenzhenica] Length = 395 Score = 63.2 bits (152), Expect = 3e-07 Identities = 30/51 (58%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 669 AGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAK-GEGSVRKLETNSRV 520 AGKICMVD+LC LC+E N+++ AALKSPVS+LL+K G VR++++NS + Sbjct: 60 AGKICMVDILCYLCSEQNITSPVAALKSPVSSLLSKDGPALVRRVDSNSSI 110 >ref|XP_020263436.1| CBS domain-containing protein CBSX5-like [Asparagus officinalis] Length = 395 Score = 63.2 bits (152), Expect = 3e-07 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -2 Query: 675 GIAGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSR 523 GI G ICMVDVLC LC++ N+ +AL++PVS LL+KG+G VR ++ +SR Sbjct: 59 GIVGDICMVDVLCYLCSQQNIKCPVSALQNPVSVLLSKGDGVVRAIDPDSR 109 >ref|XP_010241981.1| PREDICTED: CBS domain-containing protein CBSX5-like [Nelumbo nucifera] Length = 398 Score = 63.2 bits (152), Expect = 4e-07 Identities = 44/113 (38%), Positives = 63/113 (55%) Frame = -2 Query: 666 GKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRVKLRTRSFLLNF 487 GKICMVDV+C LC E N++ ++ALKSP+S LL K G VR +E + S L Sbjct: 66 GKICMVDVICFLCKEENLACPSSALKSPISVLLPKAAGIVRHVEPHF-------SLLDAI 118 Query: 486 KLESETACGKVAGKENTFLNVTSRKRSLRRGNCFPRFGGQPSAHFVNGQLICW 328 +L E A + +++ N SRK+ L++ + FG P+ H NG+ CW Sbjct: 119 RLILEGAQNLIVPIQSSISN-NSRKKLLQKSS----FG--PTLH--NGREFCW 162 >ref|XP_011082650.1| CBS domain-containing protein CBSX5 [Sesamum indicum] Length = 385 Score = 62.8 bits (151), Expect = 5e-07 Identities = 41/115 (35%), Positives = 58/115 (50%), Gaps = 2/115 (1%) Frame = -2 Query: 666 GKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRVKLRTRSFLLNF 487 GK+CMVD++C LC E N+ + A ALKSPVS LL+K +G VR ++ +S + L +L Sbjct: 61 GKVCMVDIICYLCREENLGSPALALKSPVSVLLSKVKGLVRHVDPSSSL-LEAIDLILQ- 118 Query: 486 KLESETACGKVAGKENTFLNVTSRKRSLRRGNCFPRFGGQPS--AHFVNGQLICW 328 G +N + + S R + P+ PS F NGQ CW Sbjct: 119 ------------GAQNLVVPIKSNSRRKQ----LPKASSSPSITPTFHNGQEFCW 157 >ref|XP_022874760.1| CBS domain-containing protein CBSX5-like [Olea europaea var. sylvestris] Length = 397 Score = 62.8 bits (151), Expect = 5e-07 Identities = 42/113 (37%), Positives = 59/113 (52%) Frame = -2 Query: 666 GKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRVKLRTRSFLLNF 487 GKICMVD++C LC E N+S+ A ALKSP+S LL+K +G VR +E +S S L Sbjct: 67 GKICMVDIICYLCREENLSSPALALKSPISVLLSKVQGLVRHVEASS-------SLLEAI 119 Query: 486 KLESETACGKVAGKENTFLNVTSRKRSLRRGNCFPRFGGQPSAHFVNGQLICW 328 L + A V ++ + RK+ L+ + P+ H NG CW Sbjct: 120 DLILQGAQNLVVPIKSNNTGSSKRKQLLKSSSM------SPTVH--NGLEFCW 164 >ref|XP_009382391.1| PREDICTED: CBS domain-containing protein CBSX5-like [Musa acuminata subsp. malaccensis] Length = 380 Score = 62.0 bits (149), Expect = 8e-07 Identities = 27/46 (58%), Positives = 38/46 (82%) Frame = -2 Query: 672 IAGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLE 535 + GK+C+ DVLC LC++GN+++ AAAL+ PVSALL KG G VR++E Sbjct: 60 VVGKLCVADVLCYLCSDGNLASPAAALERPVSALLPKGAGLVRRVE 105 >emb|CBI25846.3| unnamed protein product, partial [Vitis vinifera] Length = 131 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -2 Query: 666 GKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRV 520 GKICMVDV+C LC E N+S + AL+SP+S LL K G VR L+ NSR+ Sbjct: 67 GKICMVDVVCFLCREDNLSCPSDALQSPLSLLLPKVPGLVRHLKPNSRL 115 >ref|XP_020675475.1| CBS domain-containing protein CBSX5-like [Dendrobium catenatum] Length = 380 Score = 61.6 bits (148), Expect = 1e-06 Identities = 31/51 (60%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 669 AGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGS-VRKLETNSRV 520 AGK+CMVD+LC LCA+ N+S+ AAALK+PVS LL+K + VR +E++SRV Sbjct: 60 AGKLCMVDILCYLCAKDNISSPAAALKNPVSVLLSKEAAALVRCVESHSRV 110 >gb|PKU84055.1| CBS domain-containing protein CBSX5 [Dendrobium catenatum] Length = 413 Score = 61.6 bits (148), Expect = 1e-06 Identities = 31/51 (60%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 669 AGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGS-VRKLETNSRV 520 AGK+CMVD+LC LCA+ N+S+ AAALK+PVS LL+K + VR +E++SRV Sbjct: 93 AGKLCMVDILCYLCAKDNISSPAAALKNPVSVLLSKEAAALVRCVESHSRV 143 >ref|XP_020585708.1| CBS domain-containing protein CBSX5-like [Phalaenopsis equestris] Length = 381 Score = 60.1 bits (144), Expect = 3e-06 Identities = 28/51 (54%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 669 AGKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGS-VRKLETNSRV 520 AGK+CMVD+LC LCA N+S+ AAAL++PVS LL+K + VR+++++SR+ Sbjct: 60 AGKLCMVDILCYLCARENISSPAAALENPVSVLLSKESAALVRRVQSHSRI 110 >ref|XP_018851045.1| PREDICTED: CBS domain-containing protein CBSX5-like [Juglans regia] Length = 404 Score = 60.1 bits (144), Expect = 4e-06 Identities = 41/113 (36%), Positives = 59/113 (52%) Frame = -2 Query: 666 GKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRVKLRTRSFLLNF 487 GK+CMVDV+C LC + N+ + +AALK+PVSA+L K G VR LE +SR+ L Sbjct: 73 GKVCMVDVICYLCRDENLLSPSAALKAPVSAILPKIPGLVRHLEPSSRLWEAIDLIL--- 129 Query: 486 KLESETACGKVAGKENTFLNVTSRKRSLRRGNCFPRFGGQPSAHFVNGQLICW 328 + T L+ SR++ L++ P G + H NG+ CW Sbjct: 130 -----QGAQNLVVPIQTELSSYSRRKQLQK----PSTTGPTTIH--NGREFCW 171 >gb|OVA00567.1| hypothetical protein BVC80_9087g64 [Macleaya cordata] Length = 287 Score = 59.3 bits (142), Expect = 4e-06 Identities = 43/115 (37%), Positives = 62/115 (53%), Gaps = 2/115 (1%) Frame = -2 Query: 666 GKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRVKLRTRSFLLNF 487 GK+CMVDV+C LC E N+S ++ALKSPVS LL + G +R +E +S + L +L Sbjct: 70 GKVCMVDVVCYLCREENLSNPSSALKSPVSVLLPEVSGIIRHVEPHSSL-LEVIDLILE- 127 Query: 486 KLESETACGKVAGKENTFLNVTS--RKRSLRRGNCFPRFGGQPSAHFVNGQLICW 328 G +N + + S RKR L++ + FG P+ H NG+ CW Sbjct: 128 ------------GAQNLIVPLKSSPRKRLLQKSS----FG--PTLH--NGREFCW 162 >ref|XP_017232279.1| PREDICTED: CBS domain-containing protein CBSX5-like [Daucus carota subsp. sativus] gb|KZN07208.1| hypothetical protein DCAR_008045 [Daucus carota subsp. sativus] Length = 367 Score = 59.7 bits (143), Expect = 4e-06 Identities = 39/96 (40%), Positives = 53/96 (55%), Gaps = 2/96 (2%) Frame = -2 Query: 666 GKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNSRVKLRTRSFLLNF 487 GKICMVDV+C LC E N+ AAL+SP+S +L K G VR LE N+ + L ++L+ Sbjct: 60 GKICMVDVICYLCKEENIVRPLAALRSPLSEILPKVSGIVRHLEANTSL-LEAIDYILD- 117 Query: 486 KLESETACGKVAGKENTFLNV--TSRKRSLRRGNCF 385 G +N + V SRKR LR+ + F Sbjct: 118 ------------GTQNLIVPVQNNSRKRVLRKPSSF 141 >gb|KVI10497.1| Cystathionine beta-synthase, core [Cynara cardunculus var. scolymus] Length = 399 Score = 59.7 bits (143), Expect = 5e-06 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -2 Query: 666 GKICMVDVLCVLCAEGNVSALAAALKSPVSALLAKGEGSVRKLETNS 526 GKICMVD++C LC E N+S+ ++ALKSPVSALL+ G VR +E +S Sbjct: 70 GKICMVDIICYLCKEDNISSPSSALKSPVSALLSHVPGVVRHVELSS 116