BLASTX nr result
ID: Ophiopogon24_contig00013299
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00013299 (912 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020081813.1| probable ribosomal protein S11, mitochondria... 75 1e-12 gb|AAP76372.1| small subunit ribosomal protein, partial (mitocho... 65 3e-09 gb|AAP76368.1| small subunit ribosomal protein, partial (mitocho... 63 9e-09 gb|AAP76367.1| small subunit ribosomal protein, partial (mitocho... 63 9e-09 gb|AAP76366.1| small subunit ribosomal protein, partial (mitocho... 63 9e-09 gb|AAP76369.1| small subunit ribosomal protein, partial (mitocho... 62 3e-08 gb|AAP76370.1| small subunit ribosomal protein, partial (mitocho... 59 2e-07 ref|XP_020571678.1| probable ribosomal protein S11, mitochondria... 60 3e-07 gb|AAP76365.1| small subunit ribosomal protein, partial (mitocho... 57 1e-06 >ref|XP_020081813.1| probable ribosomal protein S11, mitochondrial [Ananas comosus] Length = 188 Score = 75.5 bits (184), Expect = 1e-12 Identities = 40/51 (78%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = +2 Query: 761 KTTANTDRLGLA-GAGSFKSMNFVQSILEEDEQSSRENKRDFVHVLLSRKK 910 KT A TDRLGLA GAGS KSMNFVQSI EED+Q SR+ KRDFVHVLL +KK Sbjct: 20 KTRAETDRLGLAAGAGSLKSMNFVQSISEEDKQCSRKKKRDFVHVLLMKKK 70 >gb|AAP76372.1| small subunit ribosomal protein, partial (mitochondrion) [Juncus sp. Qiu 94042] Length = 126 Score = 64.7 bits (156), Expect = 3e-09 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 800 AGSFKSMNFVQSILEEDEQSSRENKRDFVHVLLSRKK 910 AGSF+SMNFV+SILEEDEQSSR+ KRDFVHVLL +KK Sbjct: 1 AGSFQSMNFVKSILEEDEQSSRKKKRDFVHVLLMKKK 37 >gb|AAP76368.1| small subunit ribosomal protein, partial (mitochondrion) [Dracaena fragrans] Length = 126 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +2 Query: 800 AGSFKSMNFVQSILEEDEQSSRENKRDFVHVLLSRKK 910 AGSFKSMNFVQSI EEDEQ SR+ KRDFVHVLL +KK Sbjct: 1 AGSFKSMNFVQSISEEDEQCSRKKKRDFVHVLLIKKK 37 >gb|AAP76367.1| small subunit ribosomal protein, partial (mitochondrion) [Prosartes hookeri] Length = 126 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +2 Query: 800 AGSFKSMNFVQSILEEDEQSSRENKRDFVHVLLSRKK 910 AGSFKSMNFVQSI EEDEQ SR+ KRDFVHVLL +KK Sbjct: 1 AGSFKSMNFVQSISEEDEQCSRKKKRDFVHVLLIKKK 37 >gb|AAP76366.1| small subunit ribosomal protein, partial (mitochondrion) [Hosta sp. Qiu 94191] Length = 126 Score = 63.2 bits (152), Expect = 9e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +2 Query: 800 AGSFKSMNFVQSILEEDEQSSRENKRDFVHVLLSRKK 910 AGSFKSMNFVQSI EEDEQ SR+ KRDFVHVLL +KK Sbjct: 1 AGSFKSMNFVQSISEEDEQCSRKKKRDFVHVLLIKKK 37 >gb|AAP76369.1| small subunit ribosomal protein, partial (mitochondrion) [Typha sp. Qiu 94061] Length = 126 Score = 61.6 bits (148), Expect = 3e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 800 AGSFKSMNFVQSILEEDEQSSRENKRDFVHVLLSRKK 910 AGSFKSMNFVQSI EEDEQ SR+ RDFVHVLL +KK Sbjct: 1 AGSFKSMNFVQSISEEDEQCSRKKNRDFVHVLLMKKK 37 >gb|AAP76370.1| small subunit ribosomal protein, partial (mitochondrion) [Cocos nucifera] Length = 126 Score = 59.3 bits (142), Expect = 2e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +2 Query: 800 AGSFKSMNFVQSILEEDEQSSRENKRDFVHVLLSRKK 910 AGSFKSMNFVQSI EEDEQ SR+ RDFVHVLL + K Sbjct: 1 AGSFKSMNFVQSISEEDEQCSRKKNRDFVHVLLIKNK 37 >ref|XP_020571678.1| probable ribosomal protein S11, mitochondrial [Phalaenopsis equestris] Length = 174 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +2 Query: 782 RLGLAGAGSFKSMNFVQSILEEDEQSSRENKRDFVHVLLSRKK 910 RLGLAG G+FK +NFVQSI EEDEQ SR+ +FVHVLL +KK Sbjct: 54 RLGLAGDGNFKFINFVQSISEEDEQCSRKKNINFVHVLLIKKK 96 >gb|AAP76365.1| small subunit ribosomal protein, partial (mitochondrion) [Pandanus tectorius] Length = 126 Score = 57.0 bits (136), Expect = 1e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 800 AGSFKSMNFVQSILEEDEQSSRENKRDFVHVLLSRKK 910 AGSFKSMNFVQSI EEDEQ SR+ DFVHVLL + K Sbjct: 1 AGSFKSMNFVQSISEEDEQCSRKKNTDFVHVLLIKNK 37