BLASTX nr result
ID: Ophiopogon24_contig00013261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00013261 (537 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268697.1| uncharacterized protein LOC109844146 isoform... 65 8e-09 ref|XP_020268696.1| uncharacterized protein LOC109844146 isoform... 65 8e-09 ref|XP_020268695.1| uncharacterized protein LOC109844146 isoform... 65 8e-09 >ref|XP_020268697.1| uncharacterized protein LOC109844146 isoform X3 [Asparagus officinalis] Length = 1503 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 534 HPWHLFEGAIGLCSCAILAVIFYPKPPQRKEMSADI 427 HPWH F+GA+GL SCAILA++FYPKPPQ KE+S ++ Sbjct: 1466 HPWHPFDGAVGLGSCAILAILFYPKPPQTKEISTEV 1501 >ref|XP_020268696.1| uncharacterized protein LOC109844146 isoform X2 [Asparagus officinalis] gb|ONK66041.1| uncharacterized protein A4U43_C06F3560 [Asparagus officinalis] Length = 1752 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 534 HPWHLFEGAIGLCSCAILAVIFYPKPPQRKEMSADI 427 HPWH F+GA+GL SCAILA++FYPKPPQ KE+S ++ Sbjct: 1715 HPWHPFDGAVGLGSCAILAILFYPKPPQTKEISTEV 1750 >ref|XP_020268695.1| uncharacterized protein LOC109844146 isoform X1 [Asparagus officinalis] Length = 1753 Score = 64.7 bits (156), Expect = 8e-09 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -1 Query: 534 HPWHLFEGAIGLCSCAILAVIFYPKPPQRKEMSADI 427 HPWH F+GA+GL SCAILA++FYPKPPQ KE+S ++ Sbjct: 1716 HPWHPFDGAVGLGSCAILAILFYPKPPQTKEISTEV 1751