BLASTX nr result
ID: Ophiopogon24_contig00013038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00013038 (1484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247242.1| zinc finger protein zpr1-like [Asparagus off... 91 1e-15 ref|XP_020240910.1| zinc finger protein zpr1-like [Asparagus off... 88 9e-15 gb|ONM09581.1| ZPR1 zinc-finger domain protein [Zea mays] 83 2e-14 ref|XP_002305256.1| zinc finger family protein [Populus trichoca... 86 5e-14 ref|XP_022845889.1| zinc finger protein ZPR1 homolog isoform X2 ... 84 8e-14 ref|XP_007211831.1| zinc finger protein ZPR1 homolog [Prunus per... 85 9e-14 ref|XP_021819667.1| zinc finger protein ZPR1 homolog [Prunus avium] 85 9e-14 ref|XP_008225795.1| PREDICTED: zinc finger protein ZPR1 homolog ... 85 9e-14 gb|ONM09578.1| ZPR1 zinc-finger domain protein [Zea mays] 83 1e-13 ref|XP_017180640.1| PREDICTED: zinc finger protein ZPR1-like, pa... 82 1e-13 ref|XP_022845888.1| zinc finger protein ZPR1-like isoform X1 [Ol... 84 1e-13 ref|XP_002528505.1| PREDICTED: zinc finger protein ZPR1 [Ricinus... 84 1e-13 ref|XP_019169811.1| PREDICTED: zinc finger protein ZPR1 homolog ... 84 2e-13 gb|KRH50474.1| hypothetical protein GLYMA_07G222900 [Glycine max] 82 2e-13 ref|XP_019169810.1| PREDICTED: zinc finger protein ZPR1-like iso... 84 2e-13 gb|ONM09584.1| ZPR1 zinc-finger domain protein [Zea mays] 83 2e-13 gb|KRH50473.1| hypothetical protein GLYMA_07G222900 [Glycine max] 82 2e-13 gb|KRH50472.1| hypothetical protein GLYMA_07G222900 [Glycine max] 82 3e-13 ref|XP_009353937.1| PREDICTED: zinc finger protein ZPR1-like [Py... 83 3e-13 ref|XP_024030150.1| zinc finger protein ZPR1 [Morus notabilis] 83 3e-13 >ref|XP_020247242.1| zinc finger protein zpr1-like [Asparagus officinalis] gb|ONK56408.1| uncharacterized protein A4U43_C10F8230 [Asparagus officinalis] Length = 505 Score = 90.5 bits (223), Expect = 1e-15 Identities = 51/88 (57%), Positives = 60/88 (68%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVENSSV 182 LRAADELQ L DERKKVDP TA+AIDQ VKLRS AA SF FILDDP+GN FVEN S Sbjct: 139 LRAADELQALQDERKKVDPGTAEAIDQFLVKLRSFAAGNFSFTFILDDPSGNSFVENPSA 198 Query: 183 YIVKYMINLDSPIQAI*WEKNREEKKIL 266 ++LD + +E+ RE++ L Sbjct: 199 ------LSLDPLLSIQFYERTREQQASL 220 >ref|XP_020240910.1| zinc finger protein zpr1-like [Asparagus officinalis] gb|ONK59653.1| uncharacterized protein A4U43_C08F8890 [Asparagus officinalis] Length = 505 Score = 87.8 bits (216), Expect = 9e-15 Identities = 50/88 (56%), Positives = 58/88 (65%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVENSSV 182 LRA DELQ L DERKKVDP TA+AIDQ VKLRS AA SF FILDDPAGN F+EN S Sbjct: 139 LRAVDELQALQDERKKVDPGTAEAIDQFLVKLRSFAAGNFSFTFILDDPAGNSFIENPSA 198 Query: 183 YIVKYMINLDSPIQAI*WEKNREEKKIL 266 +LD + +E+ RE++ L Sbjct: 199 ------PSLDPLLSIQFYERTREQQASL 220 >gb|ONM09581.1| ZPR1 zinc-finger domain protein [Zea mays] Length = 219 Score = 82.8 bits (203), Expect = 2e-14 Identities = 44/88 (50%), Positives = 58/88 (65%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVENSSV 182 +RA DELQ L DERKKVDP+ A+AIDQ +KLRSL + ++F FILDDPAGN F+EN Sbjct: 39 MRAVDELQALQDERKKVDPQKAEAIDQFLLKLRSLGSGEAAFTFILDDPAGNSFIENPHA 98 Query: 183 YIVKYMINLDSPIQAI*WEKNREEKKIL 266 + LD + +E+ RE++ L Sbjct: 99 PL------LDPLLSVRFYERTREQQAAL 120 >ref|XP_002305256.1| zinc finger family protein [Populus trichocarpa] gb|PNT40065.1| hypothetical protein POPTR_004G075600v3 [Populus trichocarpa] Length = 506 Score = 85.5 bits (210), Expect = 5e-14 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 +RAADELQ L +ERKKVDPKTA+AIDQ +KLR+ AA SSF FILDDPAGN F+EN Sbjct: 141 VRAADELQALQEERKKVDPKTAEAIDQFLLKLRACAAGDSSFKFILDDPAGNSFIEN 197 >ref|XP_022845889.1| zinc finger protein ZPR1 homolog isoform X2 [Olea europaea var. sylvestris] Length = 420 Score = 84.3 bits (207), Expect = 8e-14 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 LRAADEL+ L +ERKKVDP+TA+AIDQ +KLR+ A SSFAFILDDPAGN F+EN Sbjct: 62 LRAADELEALQEERKKVDPQTAEAIDQFMMKLRACATGDSSFAFILDDPAGNSFIEN 118 >ref|XP_007211831.1| zinc finger protein ZPR1 homolog [Prunus persica] gb|ONI11495.1| hypothetical protein PRUPE_4G109100 [Prunus persica] Length = 505 Score = 84.7 bits (208), Expect = 9e-14 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 LRAADELQ L +ERKKVDP+TA+AIDQ +KLR+ A SSF FILDDPAGN FVEN Sbjct: 144 LRAADELQALQEERKKVDPQTAEAIDQFLLKLRACATADSSFTFILDDPAGNSFVEN 200 >ref|XP_021819667.1| zinc finger protein ZPR1 homolog [Prunus avium] Length = 508 Score = 84.7 bits (208), Expect = 9e-14 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 LRAADELQ L +ERKKVDP+TA+AIDQ +KLR+ A SSF FILDDPAGN FVEN Sbjct: 144 LRAADELQALQEERKKVDPQTAEAIDQFLLKLRACATADSSFTFILDDPAGNSFVEN 200 >ref|XP_008225795.1| PREDICTED: zinc finger protein ZPR1 homolog [Prunus mume] Length = 508 Score = 84.7 bits (208), Expect = 9e-14 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 LRAADELQ L +ERKKVDP+TA+AIDQ +KLR+ A SSF FILDDPAGN FVEN Sbjct: 144 LRAADELQALQEERKKVDPQTAEAIDQFLLKLRACATADSSFTFILDDPAGNSFVEN 200 >gb|ONM09578.1| ZPR1 zinc-finger domain protein [Zea mays] Length = 321 Score = 82.8 bits (203), Expect = 1e-13 Identities = 44/88 (50%), Positives = 58/88 (65%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVENSSV 182 +RA DELQ L DERKKVDP+ A+AIDQ +KLRSL + ++F FILDDPAGN F+EN Sbjct: 141 MRAVDELQALQDERKKVDPQKAEAIDQFLLKLRSLGSGEAAFTFILDDPAGNSFIENPHA 200 Query: 183 YIVKYMINLDSPIQAI*WEKNREEKKIL 266 + LD + +E+ RE++ L Sbjct: 201 PL------LDPLLSVRFYERTREQQAAL 222 >ref|XP_017180640.1| PREDICTED: zinc finger protein ZPR1-like, partial [Malus domestica] Length = 277 Score = 82.0 bits (201), Expect = 1e-13 Identities = 40/57 (70%), Positives = 46/57 (80%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 LRAADELQ L +ERKKVDP+TA+A+DQ +KLR+ A SF FILDDPAGN FVEN Sbjct: 40 LRAADELQALQEERKKVDPQTAEALDQFLLKLRACATADMSFTFILDDPAGNSFVEN 96 >ref|XP_022845888.1| zinc finger protein ZPR1-like isoform X1 [Olea europaea var. sylvestris] Length = 491 Score = 84.3 bits (207), Expect = 1e-13 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 LRAADEL+ L +ERKKVDP+TA+AIDQ +KLR+ A SSFAFILDDPAGN F+EN Sbjct: 133 LRAADELEALQEERKKVDPQTAEAIDQFMMKLRACATGDSSFAFILDDPAGNSFIEN 189 >ref|XP_002528505.1| PREDICTED: zinc finger protein ZPR1 [Ricinus communis] gb|EEF33874.1| zinc finger protein, putative [Ricinus communis] Length = 505 Score = 84.3 bits (207), Expect = 1e-13 Identities = 41/57 (71%), Positives = 47/57 (82%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 +RAADELQ L +ERKKVDPKTA+AIDQ ++LRS A SSF FILDDPAGN F+EN Sbjct: 141 VRAADELQALQEERKKVDPKTAEAIDQFLLRLRSCATGDSSFTFILDDPAGNSFIEN 197 >ref|XP_019169811.1| PREDICTED: zinc finger protein ZPR1 homolog isoform X2 [Ipomoea nil] Length = 424 Score = 83.6 bits (205), Expect = 2e-13 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 +RAAD L+ L DERKKVDPKTA+AIDQ VKLR+ A SSF FILDDPAGN F+EN Sbjct: 62 VRAADGLEALQDERKKVDPKTAEAIDQFLVKLRACATGNSSFTFILDDPAGNSFIEN 118 >gb|KRH50474.1| hypothetical protein GLYMA_07G222900 [Glycine max] Length = 338 Score = 82.4 bits (202), Expect = 2e-13 Identities = 40/57 (70%), Positives = 47/57 (82%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 +RAADELQTL +ERKKV P+TA+AIDQ VKLR+ A S+F FILDDPAGN F+EN Sbjct: 1 MRAADELQTLQEERKKVAPETAEAIDQFLVKLRACATGESAFTFILDDPAGNSFIEN 57 >ref|XP_019169810.1| PREDICTED: zinc finger protein ZPR1-like isoform X1 [Ipomoea nil] Length = 507 Score = 83.6 bits (205), Expect = 2e-13 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 +RAAD L+ L DERKKVDPKTA+AIDQ VKLR+ A SSF FILDDPAGN F+EN Sbjct: 145 VRAADGLEALQDERKKVDPKTAEAIDQFLVKLRACATGNSSFTFILDDPAGNSFIEN 201 >gb|ONM09584.1| ZPR1 zinc-finger domain protein [Zea mays] Length = 397 Score = 82.8 bits (203), Expect = 2e-13 Identities = 44/88 (50%), Positives = 58/88 (65%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVENSSV 182 +RA DELQ L DERKKVDP+ A+AIDQ +KLRSL + ++F FILDDPAGN F+EN Sbjct: 40 MRAVDELQALQDERKKVDPQKAEAIDQFLLKLRSLGSGEAAFTFILDDPAGNSFIENPHA 99 Query: 183 YIVKYMINLDSPIQAI*WEKNREEKKIL 266 + LD + +E+ RE++ L Sbjct: 100 PL------LDPLLSVRFYERTREQQAAL 121 >gb|KRH50473.1| hypothetical protein GLYMA_07G222900 [Glycine max] Length = 362 Score = 82.4 bits (202), Expect = 2e-13 Identities = 40/57 (70%), Positives = 47/57 (82%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 +RAADELQTL +ERKKV P+TA+AIDQ VKLR+ A S+F FILDDPAGN F+EN Sbjct: 1 MRAADELQTLQEERKKVAPETAEAIDQFLVKLRACATGESAFTFILDDPAGNSFIEN 57 >gb|KRH50472.1| hypothetical protein GLYMA_07G222900 [Glycine max] Length = 372 Score = 82.4 bits (202), Expect = 3e-13 Identities = 40/57 (70%), Positives = 47/57 (82%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 +RAADELQTL +ERKKV P+TA+AIDQ VKLR+ A S+F FILDDPAGN F+EN Sbjct: 11 MRAADELQTLQEERKKVAPETAEAIDQFLVKLRACATGESAFTFILDDPAGNSFIEN 67 >ref|XP_009353937.1| PREDICTED: zinc finger protein ZPR1-like [Pyrus x bretschneideri] Length = 504 Score = 83.2 bits (204), Expect = 3e-13 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 LRAADELQ L DERKKVDP+TA+A+DQ +KLR+ A SF FILDDPAGN FVEN Sbjct: 149 LRAADELQALQDERKKVDPQTAEALDQFLLKLRACATADLSFTFILDDPAGNSFVEN 205 >ref|XP_024030150.1| zinc finger protein ZPR1 [Morus notabilis] Length = 509 Score = 83.2 bits (204), Expect = 3e-13 Identities = 40/57 (70%), Positives = 47/57 (82%) Frame = +3 Query: 3 LRAADELQTLPDERKKVDPKTAKAIDQLFVKLRSLAAEYSSFAFILDDPAGNGFVEN 173 +RAADEL+ L +ERKKVDP+TA+AIDQ VKLR+ A S FAFILDDPAGN F+EN Sbjct: 146 VRAADELEALQEERKKVDPQTAEAIDQFLVKLRACATGVSPFAFILDDPAGNSFIEN 202