BLASTX nr result
ID: Ophiopogon24_contig00012848
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00012848 (608 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010914921.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 83 8e-15 gb|OVA00494.1| Cyclophilin-like peptidyl-prolyl cis-trans isomer... 83 8e-15 ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 83 8e-15 ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 83 8e-15 ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 83 8e-15 ref|XP_021893477.1| peptidyl-prolyl cis-trans isomerase CYP95 [C... 82 1e-14 ref|XP_020685842.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 82 1e-14 ref|XP_020592652.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 82 1e-14 ref|XP_020685841.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 82 1e-14 ref|XP_020592651.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 82 1e-14 ref|XP_006483323.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 82 2e-14 ref|XP_006483322.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 82 2e-14 ref|XP_006450486.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 82 2e-14 ref|XP_006483320.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 82 2e-14 ref|XP_006450487.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 82 2e-14 dbj|GAY45073.1| hypothetical protein CUMW_086710 [Citrus unshiu] 82 2e-14 gb|ERN01482.1| hypothetical protein AMTR_s00002p00269760 [Ambore... 81 4e-14 ref|XP_006838913.2| peptidyl-prolyl cis-trans isomerase CYP63 [A... 81 4e-14 ref|XP_010546571.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 80 5e-14 gb|PKA53844.1| Peptidyl-prolyl cis-trans isomerase [Apostasia sh... 80 5e-14 >ref|XP_010914921.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Elaeis guineensis] Length = 726 Score = 82.8 bits (203), Expect = 8e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 535 GSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGG 573 >gb|OVA00494.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain [Macleaya cordata] Length = 811 Score = 82.8 bits (203), Expect = 8e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSP+RSPVRSHRYGG Sbjct: 639 GSPKRIRRGRGFSQRYSYARRYRTPSPERSPVRSHRYGG 677 >ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] ref|XP_017697447.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] Length = 818 Score = 82.8 bits (203), Expect = 8e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 625 GSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGG 663 >ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Elaeis guineensis] Length = 836 Score = 82.8 bits (203), Expect = 8e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 645 GSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGG 683 >ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] Length = 842 Score = 82.8 bits (203), Expect = 8e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 649 GSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGG 687 >ref|XP_021893477.1| peptidyl-prolyl cis-trans isomerase CYP95 [Carica papaya] Length = 476 Score = 82.0 bits (201), Expect = 1e-14 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 295 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSYRYGG 333 >ref|XP_020685842.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Dendrobium catenatum] ref|XP_020685843.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Dendrobium catenatum] Length = 744 Score = 82.0 bits (201), Expect = 1e-14 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSPVR HRYGG Sbjct: 559 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRLHRYGG 597 >ref|XP_020592652.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Phalaenopsis equestris] Length = 850 Score = 82.0 bits (201), Expect = 1e-14 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSPVR HRYGG Sbjct: 666 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRLHRYGG 704 >ref|XP_020685841.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Dendrobium catenatum] Length = 854 Score = 82.0 bits (201), Expect = 1e-14 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSPVR HRYGG Sbjct: 669 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRLHRYGG 707 >ref|XP_020592651.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Phalaenopsis equestris] Length = 854 Score = 82.0 bits (201), Expect = 1e-14 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSPVR HRYGG Sbjct: 670 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRLHRYGG 708 >ref|XP_006483323.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Citrus sinensis] ref|XP_006483324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Citrus sinensis] ref|XP_006483325.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Citrus sinensis] Length = 691 Score = 81.6 bits (200), Expect = 2e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSP+RS+RYGG Sbjct: 519 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSYRYGG 557 >ref|XP_006483322.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Citrus sinensis] Length = 792 Score = 81.6 bits (200), Expect = 2e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSP+RS+RYGG Sbjct: 620 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSYRYGG 658 >ref|XP_006450486.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Citrus clementina] gb|ESR63726.1| hypothetical protein CICLE_v10007495mg [Citrus clementina] Length = 792 Score = 81.6 bits (200), Expect = 2e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSP+RS+RYGG Sbjct: 620 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSYRYGG 658 >ref|XP_006483320.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Citrus sinensis] ref|XP_006483321.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Citrus sinensis] gb|KDO61676.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis] gb|KDO61677.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis] gb|KDO61678.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis] Length = 801 Score = 81.6 bits (200), Expect = 2e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSP+RS+RYGG Sbjct: 629 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSYRYGG 667 >ref|XP_006450487.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Citrus clementina] gb|ESR63727.1| hypothetical protein CICLE_v10007495mg [Citrus clementina] gb|ESR63728.1| hypothetical protein CICLE_v10007495mg [Citrus clementina] Length = 801 Score = 81.6 bits (200), Expect = 2e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSP+RS+RYGG Sbjct: 629 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSYRYGG 667 >dbj|GAY45073.1| hypothetical protein CUMW_086710 [Citrus unshiu] Length = 835 Score = 81.6 bits (200), Expect = 2e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSPKRIRRGRGFS RYSYARRYRTPSPDRSP+RS+RYGG Sbjct: 629 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPIRSYRYGG 667 >gb|ERN01482.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda] Length = 795 Score = 80.9 bits (198), Expect = 4e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 G+PKRIRRGRGFS RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 595 GTPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSYRYGG 633 >ref|XP_006838913.2| peptidyl-prolyl cis-trans isomerase CYP63 [Amborella trichopoda] Length = 800 Score = 80.9 bits (198), Expect = 4e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 G+PKRIRRGRGFS RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 600 GTPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSYRYGG 638 >ref|XP_010546571.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Tarenaya hassleriana] Length = 735 Score = 80.5 bits (197), Expect = 5e-14 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYG 347 GSPKRIRRGRGFS RYSYARRYRTPSPDRSP RSHRYG Sbjct: 565 GSPKRIRRGRGFSQRYSYARRYRTPSPDRSPARSHRYG 602 >gb|PKA53844.1| Peptidyl-prolyl cis-trans isomerase [Apostasia shenzhenica] Length = 776 Score = 80.5 bits (197), Expect = 5e-14 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +3 Query: 234 GSPKRIRRGRGFSHRYSYARRYRTPSPDRSPVRSHRYGG 350 GSP+RIRRGRGFS RYSYARRYRTPSPDRSP+R HRYGG Sbjct: 588 GSPRRIRRGRGFSQRYSYARRYRTPSPDRSPIRFHRYGG 626