BLASTX nr result
ID: Ophiopogon24_contig00012108
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00012108 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240865.1| probable pyridoxal 5'-phosphate synthase sub... 56 2e-06 >ref|XP_020240865.1| probable pyridoxal 5'-phosphate synthase subunit PDX2 [Asparagus officinalis] gb|ONK79637.1| uncharacterized protein A4U43_C01F8400 [Asparagus officinalis] Length = 254 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 446 SVEKSLQCTSTSELDLENNLQGKRSYDLPIFE 351 S EKS + TSTSELDLENNLQGKRSYDLPIFE Sbjct: 223 SHEKSSKNTSTSELDLENNLQGKRSYDLPIFE 254