BLASTX nr result
ID: Ophiopogon24_contig00012084
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00012084 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265358.1| glycerophosphodiester phosphodiesterase GDPD... 60 5e-08 >ref|XP_020265358.1| glycerophosphodiester phosphodiesterase GDPDL3-like [Asparagus officinalis] gb|ONK70122.1| uncharacterized protein A4U43_C05F30490 [Asparagus officinalis] Length = 756 Score = 60.5 bits (145), Expect = 5e-08 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = -2 Query: 324 EPPLPPA-VKPTISVPPTSQPSAGPPQHLAAVFSLPWAIAMLTGALLL 184 EPPLPPA +KP +S+PP SQPS G P+HL A F L AIA ++G LLL Sbjct: 709 EPPLPPASLKPAVSIPPASQPSEGSPRHLFASFLLSLAIATVSGLLLL 756