BLASTX nr result
ID: Ophiopogon24_contig00011935
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00011935 (341 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP56022.1| phytoene synthase, partial [Zea mays] >gi|3234949... 52 7e-07 gb|AAP56021.1| phytoene synthase, partial [Zea mays] >gi|3234950... 52 7e-07 gb|AAP56012.1| phytoene synthase, partial [Zea mays] >gi|3234945... 52 7e-07 gb|ANJ46008.1| phytoene synthase, partial [Phalaenopsis amabilis] 54 1e-06 gb|ANJ46006.1| phytoene synthase, partial [Phalaenopsis lueddema... 54 1e-06 gb|ACF07859.1| phytoene synthase, partial [Oryza sativa Indica G... 53 1e-06 gb|ACU44500.1| phytoene synthase, partial [Elaeagnus umbellata] 54 1e-06 gb|ANJ46007.1| phytoene synthase, partial [Phalaenopsis amabilis] 54 1e-06 gb|ANJ46005.1| phytoene synthase, partial [Phalaenopsis lueddema... 54 1e-06 ref|XP_023522977.1| phytoene synthase 2, chloroplastic-like, par... 54 1e-06 emb|CAI60776.1| phytoene synthase, partial [Crocus sativus] 54 1e-06 gb|ANJ46004.1| phytoene synthase, partial [Phalaenopsis violacea] 54 1e-06 ref|XP_022637742.1| phytoene synthase 2, chloroplastic isoform X... 56 1e-06 ref|XP_014504995.1| phytoene synthase 2, chloroplastic isoform X... 56 1e-06 ref|XP_017430735.1| PREDICTED: phytoene synthase 2, chloroplasti... 56 1e-06 gb|AIU48697.1| phytoene synthase, partial [Pinellia ternata] 55 2e-06 ref|XP_020112401.1| phytoene synthase 2, chloroplastic-like [Ana... 55 2e-06 gb|ALQ56924.1| phytoene synthase [Crocus ancyrensis] 55 2e-06 gb|AIU48712.1| phytoene synthase, partial [Ceratophyllum demersum] 54 2e-06 gb|PNS96790.1| hypothetical protein POPTR_017G138900v3 [Populus ... 55 3e-06 >gb|AAP56022.1| phytoene synthase, partial [Zea mays] gb|AAP56048.1| phytoene synthase, partial [Zea mays] gb|AAP56067.1| phytoene synthase, partial [Zea mays] gb|AAP56070.1| phytoene synthase, partial [Zea mays] gb|AAP56075.1| phytoene synthase, partial [Zea mays] Length = 54 Score = 52.4 bits (124), Expect = 7e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNA+ ITP+ALDRWE RLE Sbjct: 1 RTDELVDGPNANYITPTALDRWEKRLE 27 >gb|AAP56021.1| phytoene synthase, partial [Zea mays] gb|AAP56052.1| phytoene synthase, partial [Zea mays] gb|AAP56054.1| phytoene synthase, partial [Zea mays] gb|AAP56056.1| phytoene synthase, partial [Zea mays] gb|AAP56057.1| phytoene synthase, partial [Zea mays] gb|AAP56065.1| phytoene synthase, partial [Zea mays] Length = 55 Score = 52.4 bits (124), Expect = 7e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNA+ ITP+ALDRWE RLE Sbjct: 2 RTDELVDGPNANYITPTALDRWEKRLE 28 >gb|AAP56012.1| phytoene synthase, partial [Zea mays] gb|AAP56030.1| phytoene synthase, partial [Zea mays] gb|AAP56032.1| phytoene synthase, partial [Zea mays] gb|AAP56035.1| phytoene synthase, partial [Zea mays] gb|AAP56036.1| phytoene synthase, partial [Zea mays] gb|AAP56037.1| phytoene synthase, partial [Zea mays] gb|AAP56051.1| phytoene synthase, partial [Zea mays] gb|AAP56053.1| phytoene synthase, partial [Zea mays] gb|AAP56059.1| phytoene synthase, partial [Zea mays] gb|AAP56062.1| phytoene synthase, partial [Zea mays] gb|AAP56063.1| phytoene synthase, partial [Zea mays] gb|AAP56077.1| phytoene synthase, partial [Zea mays] gb|AAP56078.1| phytoene synthase, partial [Zea mays] gb|AAP56081.1| phytoene synthase, partial [Zea mays] gb|AAP56083.1| phytoene synthase, partial [Zea mays] Length = 57 Score = 52.4 bits (124), Expect = 7e-07 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNA+ ITP+ALDRWE RLE Sbjct: 4 RTDELVDGPNANYITPTALDRWEKRLE 30 >gb|ANJ46008.1| phytoene synthase, partial [Phalaenopsis amabilis] Length = 151 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWE+RLE Sbjct: 85 RTDELVDGPNASHITPSALDRWEARLE 111 >gb|ANJ46006.1| phytoene synthase, partial [Phalaenopsis lueddemanniana] Length = 151 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWE+RLE Sbjct: 85 RTDELVDGPNASHITPSALDRWEARLE 111 >gb|ACF07859.1| phytoene synthase, partial [Oryza sativa Indica Group] Length = 84 Score = 52.8 bits (125), Expect = 1e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWE RL+ Sbjct: 45 RTDELVDGPNASHITPSALDRWEKRLD 71 >gb|ACU44500.1| phytoene synthase, partial [Elaeagnus umbellata] Length = 135 Score = 53.9 bits (128), Expect = 1e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITP ALDRWESRLE Sbjct: 21 RTDELVDGPNASHITPKALDRWESRLE 47 >gb|ANJ46007.1| phytoene synthase, partial [Phalaenopsis amabilis] Length = 156 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWE+RLE Sbjct: 103 RTDELVDGPNASHITPSALDRWEARLE 129 >gb|ANJ46005.1| phytoene synthase, partial [Phalaenopsis lueddemanniana] Length = 156 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWE+RLE Sbjct: 103 RTDELVDGPNASHITPSALDRWEARLE 129 >ref|XP_023522977.1| phytoene synthase 2, chloroplastic-like, partial [Cucurbita pepo subsp. pepo] Length = 159 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWE+RLE Sbjct: 27 RTDELVDGPNASHITPSALDRWEARLE 53 >emb|CAI60776.1| phytoene synthase, partial [Crocus sativus] Length = 140 Score = 53.9 bits (128), Expect = 1e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWE++LE Sbjct: 34 RTDELVDGPNASYITPSALDRWEAKLE 60 >gb|ANJ46004.1| phytoene synthase, partial [Phalaenopsis violacea] Length = 160 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWE+RLE Sbjct: 101 RTDELVDGPNASHITPSALDRWEARLE 127 >ref|XP_022637742.1| phytoene synthase 2, chloroplastic isoform X2 [Vigna radiata var. radiata] Length = 377 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWESRLE Sbjct: 180 RTDELVDGPNASQITPSALDRWESRLE 206 >ref|XP_014504995.1| phytoene synthase 2, chloroplastic isoform X1 [Vigna radiata var. radiata] ref|XP_014504996.1| phytoene synthase 2, chloroplastic isoform X1 [Vigna radiata var. radiata] ref|XP_014504997.1| phytoene synthase 2, chloroplastic isoform X1 [Vigna radiata var. radiata] ref|XP_022637741.1| phytoene synthase 2, chloroplastic isoform X1 [Vigna radiata var. radiata] Length = 435 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWESRLE Sbjct: 180 RTDELVDGPNASQITPSALDRWESRLE 206 >ref|XP_017430735.1| PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] ref|XP_017430736.1| PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] ref|XP_017430737.1| PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] ref|XP_017430738.1| PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] gb|KOM47099.1| hypothetical protein LR48_Vigan07g080300 [Vigna angularis] dbj|BAT81313.1| hypothetical protein VIGAN_03100300 [Vigna angularis var. angularis] Length = 435 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWESRLE Sbjct: 180 RTDELVDGPNASQITPSALDRWESRLE 206 >gb|AIU48697.1| phytoene synthase, partial [Pinellia ternata] Length = 329 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWESRLE Sbjct: 86 RTDELVDGPNASHITPSALDRWESRLE 112 >ref|XP_020112401.1| phytoene synthase 2, chloroplastic-like [Ananas comosus] ref|XP_020112402.1| phytoene synthase 2, chloroplastic-like [Ananas comosus] Length = 420 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWESRLE Sbjct: 162 RTDELVDGPNASHITPSALDRWESRLE 188 >gb|ALQ56924.1| phytoene synthase [Crocus ancyrensis] Length = 421 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS ITPSALDRWESRLE Sbjct: 160 RTDELVDGPNASHITPSALDRWESRLE 186 >gb|AIU48712.1| phytoene synthase, partial [Ceratophyllum demersum] Length = 208 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +3 Query: 261 RTDELVDGPNASLITPSALDRWESRLE 341 RTDELVDGPNAS +TPSALDRWESRLE Sbjct: 87 RTDELVDGPNASHMTPSALDRWESRLE 113 >gb|PNS96790.1| hypothetical protein POPTR_017G138900v3 [Populus trichocarpa] Length = 282 Score = 54.7 bits (130), Expect = 3e-06 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = +3 Query: 183 DKPYKYFLLHYLCLV--CRHVFLFFSHSRTDELVDGPNASLITPSALDRWESRLE 341 ++P+ +FL + V CR RTDELVDGPNAS ITP+ALDRWE+RLE Sbjct: 7 NEPFPFFLTMFSAHVVWCR---------RTDELVDGPNASHITPTALDRWEARLE 52