BLASTX nr result
ID: Ophiopogon24_contig00011658
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00011658 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240849.1| plant cysteine oxidase 2-like [Asparagus off... 62 1e-08 ref|XP_020097924.1| plant cysteine oxidase 2-like [Ananas comosus] 56 3e-06 gb|OAY79900.1| Plant cysteine oxidase 2 [Ananas comosus] 56 3e-06 >ref|XP_020240849.1| plant cysteine oxidase 2-like [Asparagus officinalis] Length = 278 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 446 SEGEQYAWLEERERKPDGLAVLGAKYKGPRIVEH 345 SEGE YAWLEE+E+KPD L V+GAKYKGP+IV+H Sbjct: 245 SEGEMYAWLEEKEKKPDDLIVVGAKYKGPKIVQH 278 >ref|XP_020097924.1| plant cysteine oxidase 2-like [Ananas comosus] Length = 276 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 443 EGEQYAWLEERERKPDGLAVLGAKYKGPRIVEH 345 EGE YAWLEERER PD + V+GAKY+GPRIVEH Sbjct: 245 EGEGYAWLEERER-PDDVLVVGAKYRGPRIVEH 276 >gb|OAY79900.1| Plant cysteine oxidase 2 [Ananas comosus] Length = 276 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 443 EGEQYAWLEERERKPDGLAVLGAKYKGPRIVEH 345 EGE YAWLEERER PD + V+GAKY+GPRIVEH Sbjct: 245 EGEGYAWLEERER-PDDVLVVGAKYRGPRIVEH 276