BLASTX nr result
ID: Ophiopogon24_contig00011656
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00011656 (710 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240849.1| plant cysteine oxidase 2-like [Asparagus off... 68 7e-10 ref|XP_020097924.1| plant cysteine oxidase 2-like [Ananas comosus] 58 3e-06 gb|OAY79900.1| Plant cysteine oxidase 2 [Ananas comosus] 58 3e-06 >ref|XP_020240849.1| plant cysteine oxidase 2-like [Asparagus officinalis] Length = 278 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/43 (67%), Positives = 38/43 (88%) Frame = -2 Query: 661 IAGNPTSAFSEGEWYAWLEERECKPDELVVLGAKYKGPRIVEH 533 I+ +P +A SEGE YAWLEE+E KPD+L+V+GAKYKGP+IV+H Sbjct: 236 ISEDPAAASSEGEMYAWLEEKEKKPDDLIVVGAKYKGPKIVQH 278 >ref|XP_020097924.1| plant cysteine oxidase 2-like [Ananas comosus] Length = 276 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 670 FCPIAGNPTSAFSEGEWYAWLEERECKPDELVVLGAKYKGPRIVEH 533 + G+ EGE YAWLEERE +PD+++V+GAKY+GPRIVEH Sbjct: 232 YASFPGDAALVTGEGEGYAWLEERE-RPDDVLVVGAKYRGPRIVEH 276 >gb|OAY79900.1| Plant cysteine oxidase 2 [Ananas comosus] Length = 276 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 670 FCPIAGNPTSAFSEGEWYAWLEERECKPDELVVLGAKYKGPRIVEH 533 + G+ EGE YAWLEERE +PD+++V+GAKY+GPRIVEH Sbjct: 232 YASFPGDAALVTGEGEGYAWLEERE-RPDDVLVVGAKYRGPRIVEH 276