BLASTX nr result
ID: Ophiopogon24_contig00011613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00011613 (963 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015871293.1| PREDICTED: uncharacterized protein LOC107408... 54 6e-06 >ref|XP_015871293.1| PREDICTED: uncharacterized protein LOC107408416, partial [Ziziphus jujuba] Length = 90 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 1 EAVEEASDSQALKQIESQIQKKLEAWSNSFNKAFEN 108 EAVEEA+DSQALKQ++SQ+Q+KLE WSN F AF N Sbjct: 28 EAVEEAADSQALKQLQSQMQEKLEHWSNLFAIAFRN 63