BLASTX nr result
ID: Ophiopogon24_contig00011594
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00011594 (1970 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79317.1| hypothetical protein VITISV_008344 [Vitis vinifera] 56 6e-06 >emb|CAN79317.1| hypothetical protein VITISV_008344 [Vitis vinifera] Length = 118 Score = 56.2 bits (134), Expect = 6e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -1 Query: 377 YVVFVGRCPGLYSRLPECEQQISGYKKAVHQ*YNTYEEAEKAFMEY 240 YVVF GR G+Y+ PEC++Q+ GYK V++ Y T+EEA +A+M Y Sbjct: 32 YVVFAGRKKGIYNSWPECQEQVVGYKGNVYKLYKTFEEARRAWMFY 77