BLASTX nr result
ID: Ophiopogon24_contig00011551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00011551 (1744 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014048640.1| PREDICTED: leucine-rich repeat extensin-like... 60 1e-06 >ref|XP_014048640.1| PREDICTED: leucine-rich repeat extensin-like protein 2 [Salmo salar] Length = 205 Score = 60.1 bits (144), Expect = 1e-06 Identities = 37/120 (30%), Positives = 46/120 (38%), Gaps = 6/120 (5%) Frame = -1 Query: 1027 SPRPYQHHRNNIQTHQASSPSRATKHPPPPVSHNTHLQDPTAPQTQPNTHTATPPQSSPQ 848 +P P HH + T +P T PPP H+ H T P P+ H T +P Sbjct: 83 TPPPAPHHHHPTTTTPPPAPQHHTTTTPPPAPHHPHPTTSTPPPA-PHQHPTTSTPPAPH 141 Query: 847 GQHH------YHHNQHLVTTSTPTPQTPHKILNDKPNNIITTPNHRLKHHTNITALSPPH 686 QHH H+QH +T P P H I T P +HHT T PH Sbjct: 142 HQHHTTTPPPAPHHQHPTSTPPPAPHHHHP-------TISTPPAPHYQHHTTTTPPPAPH 194 Score = 59.3 bits (142), Expect = 3e-06 Identities = 42/129 (32%), Positives = 53/129 (41%), Gaps = 13/129 (10%) Frame = -1 Query: 1027 SPRPYQHHRNNIQT-----HQASSPSRATKHPPPPVSHNTHLQDPTAPQTQPNTH--TAT 869 +P P QHH+++ T HQ P+ +T PPPP H+ H T P + H T T Sbjct: 40 TPPPAQHHQHHTTTPPPAPHQ--HPTTSTTPPPPPAPHHQHHTTSTPPPAPHHHHPTTTT 97 Query: 868 PPQSSPQGQHHYHHNQHLVTTSTPTPQTPHKILNDKP------NNIITTPNHRLKHHTNI 707 PP P QH H TT P P PH + P T P +HHT Sbjct: 98 PP---PAPQH------HTTTTPPPAPHHPHPTTSTPPPAPHQHPTTSTPPAPHHQHHTTT 148 Query: 706 TALSPPHLH 680 +P H H Sbjct: 149 PPPAPHHQH 157