BLASTX nr result
ID: Ophiopogon24_contig00011547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00011547 (818 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81120.1| uncharacterized protein A4U43_C01F25520 [Asparagu... 57 8e-06 >gb|ONK81120.1| uncharacterized protein A4U43_C01F25520 [Asparagus officinalis] Length = 268 Score = 57.0 bits (136), Expect = 8e-06 Identities = 37/99 (37%), Positives = 51/99 (51%) Frame = -1 Query: 500 MTNRVDNEMSNAGSEGLAIFNMDFKSKGVQMAGAICQKWGNICLGNIVDQMQFKYVNSVG 321 MTN V N + E ++FNM F S G+ +ICQ C NI KYVN+ G Sbjct: 1 MTNEVKNTSCDLLEEESSLFNMGFASDGLSWVKSICQSLETSC--NIYVDTCNKYVNTAG 58 Query: 320 EQFRKVLEEVANDWLHTSNGIVEGLVSDLSLENDVITEV 204 E +K+ EEV DW + S EG +SDL ++ ++V Sbjct: 59 EHIKKIYEEV-RDWENESLFDDEGPISDLDSKHVTTSKV 96