BLASTX nr result
ID: Ophiopogon24_contig00010779
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00010779 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258560.1| uncharacterized protein LOC109834964 [Aspara... 62 7e-08 ref|XP_020258205.1| uncharacterized protein LOC109834580 [Aspara... 60 3e-07 >ref|XP_020258560.1| uncharacterized protein LOC109834964 [Asparagus officinalis] Length = 1038 Score = 61.6 bits (148), Expect = 7e-08 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +1 Query: 403 ISDFVSYDRLTPSFRQFALSLSSISIPRSFEEAVLV 510 ISDFVSY+RLTPS RQFALSLSSIS+P+S+EEA+LV Sbjct: 304 ISDFVSYNRLTPSSRQFALSLSSISLPKSYEEAMLV 339 >ref|XP_020258205.1| uncharacterized protein LOC109834580 [Asparagus officinalis] Length = 476 Score = 59.7 bits (143), Expect = 3e-07 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +1 Query: 403 ISDFVSYDRLTPSFRQFALSLSSISIPRSFEEAVLV 510 IS FVSYDRL PSFRQFALSLS++SIPRS+E+A+LV Sbjct: 433 ISLFVSYDRLNPSFRQFALSLSTVSIPRSYEKAMLV 468