BLASTX nr result
ID: Ophiopogon24_contig00010732
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00010732 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59555.1| uncharacterized protein A4U43_C08F7670 [Asparagus... 56 2e-06 ref|XP_020244941.1| DExH-box ATP-dependent RNA helicase DExH15 c... 56 2e-06 ref|XP_020244940.1| DExH-box ATP-dependent RNA helicase DExH15 c... 56 2e-06 ref|XP_018686227.1| PREDICTED: DExH-box ATP-dependent RNA helica... 55 4e-06 ref|XP_009414118.1| PREDICTED: DExH-box ATP-dependent RNA helica... 55 4e-06 ref|XP_021292965.1| DExH-box ATP-dependent RNA helicase DExH15 c... 55 7e-06 ref|XP_008798023.1| PREDICTED: DExH-box ATP-dependent RNA helica... 54 9e-06 ref|XP_010913419.1| PREDICTED: DExH-box ATP-dependent RNA helica... 54 9e-06 ref|XP_008798022.1| PREDICTED: DExH-box ATP-dependent RNA helica... 54 9e-06 >gb|ONK59555.1| uncharacterized protein A4U43_C08F7670 [Asparagus officinalis] Length = 1109 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 4 QIPKLPDIDPLLQNCASQASSVMDRAPISELFG 102 QIPKLPDIDPLLQ+ ASQAS+VMDR P+SEL G Sbjct: 1077 QIPKLPDIDPLLQSRASQASAVMDRVPLSELAG 1109 >ref|XP_020244941.1| DExH-box ATP-dependent RNA helicase DExH15 chloroplastic isoform X2 [Asparagus officinalis] Length = 1144 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 4 QIPKLPDIDPLLQNCASQASSVMDRAPISELFG 102 QIPKLPDIDPLLQ+ ASQAS+VMDR P+SEL G Sbjct: 1112 QIPKLPDIDPLLQSRASQASAVMDRVPLSELAG 1144 >ref|XP_020244940.1| DExH-box ATP-dependent RNA helicase DExH15 chloroplastic isoform X1 [Asparagus officinalis] Length = 1158 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 4 QIPKLPDIDPLLQNCASQASSVMDRAPISELFG 102 QIPKLPDIDPLLQ+ ASQAS+VMDR P+SEL G Sbjct: 1126 QIPKLPDIDPLLQSRASQASAVMDRVPLSELAG 1158 >ref|XP_018686227.1| PREDICTED: DExH-box ATP-dependent RNA helicase DExH15 chloroplastic isoform X2 [Musa acuminata subsp. malaccensis] Length = 1003 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 4 QIPKLPDIDPLLQNCASQASSVMDRAPISELFG 102 QIPKLPDIDPLLQN A ASSVMDRAPI+EL G Sbjct: 971 QIPKLPDIDPLLQNNALLASSVMDRAPINELAG 1003 >ref|XP_009414118.1| PREDICTED: DExH-box ATP-dependent RNA helicase DExH15 chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] Length = 1169 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +1 Query: 4 QIPKLPDIDPLLQNCASQASSVMDRAPISELFG 102 QIPKLPDIDPLLQN A ASSVMDRAPI+EL G Sbjct: 1137 QIPKLPDIDPLLQNNALLASSVMDRAPINELAG 1169 >ref|XP_021292965.1| DExH-box ATP-dependent RNA helicase DExH15 chloroplastic [Herrania umbratica] Length = 1166 Score = 54.7 bits (130), Expect = 7e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +1 Query: 4 QIPKLPDIDPLLQNCASQASSVMDRAPISELFG 102 QIPKLPDIDPLLQN A+ AS VMDR PISEL G Sbjct: 1134 QIPKLPDIDPLLQNNATTASDVMDRPPISELAG 1166 >ref|XP_008798023.1| PREDICTED: DExH-box ATP-dependent RNA helicase DExH15 chloroplastic isoform X2 [Phoenix dactylifera] Length = 1168 Score = 54.3 bits (129), Expect = 9e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 4 QIPKLPDIDPLLQNCASQASSVMDRAPISELFG 102 QIPKLPDIDPLLQN A AS+VMDRAPI+EL G Sbjct: 1136 QIPKLPDIDPLLQNNALLASNVMDRAPINELAG 1168 >ref|XP_010913419.1| PREDICTED: DExH-box ATP-dependent RNA helicase DExH15 chloroplastic [Elaeis guineensis] Length = 1169 Score = 54.3 bits (129), Expect = 9e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 4 QIPKLPDIDPLLQNCASQASSVMDRAPISELFG 102 QIPKLPDIDPL+QN A AS+VMDRAPISEL G Sbjct: 1137 QIPKLPDIDPLVQNNALLASNVMDRAPISELAG 1169 >ref|XP_008798022.1| PREDICTED: DExH-box ATP-dependent RNA helicase DExH15 chloroplastic isoform X1 [Phoenix dactylifera] Length = 1169 Score = 54.3 bits (129), Expect = 9e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 4 QIPKLPDIDPLLQNCASQASSVMDRAPISELFG 102 QIPKLPDIDPLLQN A AS+VMDRAPI+EL G Sbjct: 1137 QIPKLPDIDPLLQNNALLASNVMDRAPINELAG 1169