BLASTX nr result
ID: Ophiopogon24_contig00010684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00010684 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009419614.1| PREDICTED: cyclic nucleotide-gated ion chann... 63 7e-09 ref|XP_010904933.2| PREDICTED: cyclic nucleotide-gated ion chann... 63 7e-09 ref|XP_020227176.1| cyclic nucleotide-gated ion channel 4-like [... 61 3e-08 gb|PHT51670.1| Cyclic nucleotide-gated ion channel 4 [Capsicum b... 60 3e-08 gb|PLY63550.1| hypothetical protein LSAT_0X5220 [Lactuca sativa] 59 3e-08 gb|PNX94183.1| cyclic nucleotide-gated ion channel 4-like protei... 59 3e-08 dbj|GAU39173.1| hypothetical protein TSUD_372730 [Trifolium subt... 59 3e-08 ref|XP_008777136.1| PREDICTED: cyclic nucleotide-gated ion chann... 61 3e-08 ref|XP_013445570.1| cyclic nucleotide-gated ion channel-like pro... 60 5e-08 gb|AGV54453.1| cyclic nucleotide-gated ion channel 4-like protei... 60 6e-08 ref|XP_021644704.1| cyclic nucleotide-gated ion channel 4-like [... 60 6e-08 ref|XP_019183477.1| PREDICTED: cyclic nucleotide-gated ion chann... 60 6e-08 ref|XP_008386094.1| PREDICTED: cyclic nucleotide-gated ion chann... 60 6e-08 ref|XP_003526201.1| PREDICTED: cyclic nucleotide-gated ion chann... 60 6e-08 ref|XP_004294484.1| PREDICTED: cyclic nucleotide-gated ion chann... 60 6e-08 ref|XP_007132934.1| hypothetical protein PHAVU_011G137200g [Phas... 60 6e-08 gb|PIN19628.1| K+-channel ERG [Handroanthus impetiginosus] 60 9e-08 ref|XP_008226715.1| PREDICTED: cyclic nucleotide-gated ion chann... 60 9e-08 ref|XP_021829941.1| cyclic nucleotide-gated ion channel 4 [Prunu... 60 9e-08 ref|XP_007213607.1| cyclic nucleotide-gated ion channel 4 [Prunu... 60 9e-08 >ref|XP_009419614.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Musa acuminata subsp. malaccensis] Length = 638 Score = 62.8 bits (151), Expect = 7e-09 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +1 Query: 247 TTRQPNQPHAPHQSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 +T + P + Q+ W+ EWNR FLL+CAAGL +DPLFFYALSI Sbjct: 19 STFRRRNPSSDRQAKWLHEWNRIFLLICAAGLVVDPLFFYALSI 62 >ref|XP_010904933.2| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Elaeis guineensis] Length = 661 Score = 62.8 bits (151), Expect = 7e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 QS W+QEWNR FLLVC AGL +DPLFFYALSI Sbjct: 55 QSRWVQEWNRAFLLVCTAGLVVDPLFFYALSI 86 >ref|XP_020227176.1| cyclic nucleotide-gated ion channel 4-like [Cajanus cajan] gb|KYP55304.1| Cyclic nucleotide-gated ion channel 4 [Cajanus cajan] Length = 684 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 +S W+QEWNR FLLVCAAGL +DPLFFYALS+ Sbjct: 74 RSKWVQEWNRVFLLVCAAGLFVDPLFFYALSV 105 >gb|PHT51670.1| Cyclic nucleotide-gated ion channel 4 [Capsicum baccatum] Length = 193 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 268 PHAPHQSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 P AP W+QEWNR FLLVCA GL +DPLFFYALSI Sbjct: 66 PRAP----WVQEWNRVFLLVCATGLFVDPLFFYALSI 98 >gb|PLY63550.1| hypothetical protein LSAT_0X5220 [Lactuca sativa] Length = 176 Score = 59.3 bits (142), Expect = 3e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 +S W+QEWNR FLLVCA GL IDPLFFY LSI Sbjct: 54 RSEWVQEWNRAFLLVCATGLFIDPLFFYTLSI 85 >gb|PNX94183.1| cyclic nucleotide-gated ion channel 4-like protein [Trifolium pratense] Length = 185 Score = 59.3 bits (142), Expect = 3e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCAAGL +DPLFFYAL+I Sbjct: 69 RAKWVQEWNRVFLLVCAAGLFVDPLFFYALNI 100 >dbj|GAU39173.1| hypothetical protein TSUD_372730 [Trifolium subterraneum] Length = 185 Score = 59.3 bits (142), Expect = 3e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCAAGL +DPLFFYAL+I Sbjct: 71 RAKWVQEWNRVFLLVCAAGLFVDPLFFYALNI 102 >ref|XP_008777136.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Phoenix dactylifera] Length = 662 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 QS W+QEWNR FLLVC AGL +DPLFFY LSI Sbjct: 56 QSRWVQEWNRAFLLVCTAGLVVDPLFFYPLSI 87 >ref|XP_013445570.1| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula] gb|KEH19596.1| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula] Length = 672 Score = 60.5 bits (145), Expect = 5e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCAAGL +DPLFFYALSI Sbjct: 66 RAKWVQEWNRVFLLVCAAGLFVDPLFFYALSI 97 >gb|AGV54453.1| cyclic nucleotide-gated ion channel 4-like protein [Phaseolus vulgaris] Length = 678 Score = 60.1 bits (144), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCAAGL +DPLFFYALS+ Sbjct: 73 RAKWVQEWNRVFLLVCAAGLFVDPLFFYALSV 104 >ref|XP_021644704.1| cyclic nucleotide-gated ion channel 4-like [Hevea brasiliensis] Length = 679 Score = 60.1 bits (144), Expect = 6e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 +S W+QEWNR FLLVCA GL +DPLFFYALS+ Sbjct: 69 RSRWVQEWNRVFLLVCATGLFVDPLFFYALSV 100 >ref|XP_019183477.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Ipomoea nil] Length = 684 Score = 60.1 bits (144), Expect = 6e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 292 WIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 W+QEWNR FLLVCAAGL +DPLFFYALSI Sbjct: 70 WVQEWNRVFLLVCAAGLFVDPLFFYALSI 98 >ref|XP_008386094.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Malus domestica] Length = 691 Score = 60.1 bits (144), Expect = 6e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ WIQEWNR FLLVCA+GL IDPLFFYALSI Sbjct: 79 RAKWIQEWNRIFLLVCASGLIIDPLFFYALSI 110 >ref|XP_003526201.1| PREDICTED: cyclic nucleotide-gated ion channel 4-like [Glycine max] gb|KRH55671.1| hypothetical protein GLYMA_06G271200 [Glycine max] Length = 691 Score = 60.1 bits (144), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCAAGL +DPLFFYALS+ Sbjct: 73 RAKWVQEWNRVFLLVCAAGLFVDPLFFYALSV 104 >ref|XP_004294484.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Fragaria vesca subsp. vesca] Length = 692 Score = 60.1 bits (144), Expect = 6e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCA GL IDPLFFYALSI Sbjct: 80 RAKWVQEWNRVFLLVCATGLVIDPLFFYALSI 111 >ref|XP_007132934.1| hypothetical protein PHAVU_011G137200g [Phaseolus vulgaris] gb|ESW04928.1| hypothetical protein PHAVU_011G137200g [Phaseolus vulgaris] Length = 773 Score = 60.1 bits (144), Expect = 6e-08 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCAAGL +DPLFFYALS+ Sbjct: 166 RAKWVQEWNRVFLLVCAAGLFVDPLFFYALSV 197 >gb|PIN19628.1| K+-channel ERG [Handroanthus impetiginosus] Length = 637 Score = 59.7 bits (143), Expect = 9e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 292 WIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 W+QEWNR FLLVCAAGL +DPLFFYALSI Sbjct: 67 WVQEWNRIFLLVCAAGLFVDPLFFYALSI 95 >ref|XP_008226715.1| PREDICTED: cyclic nucleotide-gated ion channel 4 [Prunus mume] Length = 685 Score = 59.7 bits (143), Expect = 9e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCA GL IDPLFFYALSI Sbjct: 70 RAKWVQEWNRVFLLVCATGLIIDPLFFYALSI 101 >ref|XP_021829941.1| cyclic nucleotide-gated ion channel 4 [Prunus avium] Length = 686 Score = 59.7 bits (143), Expect = 9e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCA GL IDPLFFYALSI Sbjct: 71 RAKWVQEWNRVFLLVCATGLIIDPLFFYALSI 102 >ref|XP_007213607.1| cyclic nucleotide-gated ion channel 4 [Prunus persica] gb|ONI12911.1| hypothetical protein PRUPE_4G191200 [Prunus persica] gb|ARJ54282.1| cyclic nucleotide-gated channel 4 [Prunus persica] Length = 686 Score = 59.7 bits (143), Expect = 9e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 283 QSHWIQEWNRTFLLVCAAGLAIDPLFFYALSI 378 ++ W+QEWNR FLLVCA GL IDPLFFYALSI Sbjct: 71 RAKWVQEWNRVFLLVCATGLIIDPLFFYALSI 102