BLASTX nr result
ID: Ophiopogon24_contig00010655
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00010655 (3294 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009183221.1| ribosomal protein S18 (chloroplast) [Polygon... 155 1e-40 gb|AEX94646.1| ribosomal protein S18 (chloroplast) [Androstephiu... 155 1e-40 gb|AEX94645.1| ribosomal protein S18 (chloroplast) [Maianthemum ... 155 1e-40 gb|AEX94633.1| ribosomal protein S18 (chloroplast) [Ledebouria c... 155 1e-40 gb|AEX94627.1| ribosomal protein S18 (chloroplast) [Haworthia cy... 155 1e-40 ref|YP_009045588.1| ribosomal protein S18 (chloroplast) [Cypripe... 155 1e-40 gb|AEX94648.1| ribosomal protein S18 (chloroplast) [Dichelostemm... 155 1e-40 ref|YP_009327326.1| ribosomal protein S18 (chloroplast) [Agave a... 154 2e-40 ref|YP_009409259.1| ribosomal protein S18 (chloroplast) [Aloe ma... 154 3e-40 ref|YP_009334850.1| ribosomal protein S18 (chloroplast) [Hespera... 154 3e-40 gb|AEX94644.1| ribosomal protein S18 (chloroplast) [Sansevieria ... 154 3e-40 ref|YP_009229095.1| ribosomal protein S18 (chloroplast) [Iris sa... 154 3e-40 ref|YP_009431326.1| ribosomal protein S18 (chloroplast) [Agapant... 154 3e-40 gb|AEZ48815.1| ribosomal protein S18 (plastid) [Lomandra longifo... 153 5e-40 ref|YP_009335440.1| ribosomal protein S18 (chloroplast) [Oziroe ... 153 5e-40 gb|AEX94631.1| ribosomal protein S18 (chloroplast) [Bowiea volub... 153 5e-40 ref|YP_009432410.1| ribosomal protein S18 (chloroplast) [Xanthor... 153 6e-40 gb|AEX94643.1| ribosomal protein S18 (chloroplast) [Ruscus acule... 153 6e-40 ref|YP_358601.1| hypothetical protein PhapfoPp052 [Phalaenopsis ... 152 7e-40 ref|YP_009432748.1| ribosomal protein S18 (chloroplast) [Milla b... 152 9e-40 >ref|YP_009183221.1| ribosomal protein S18 (chloroplast) [Polygonatum verticillatum] ref|YP_009236382.1| ribosomal protein S18 (chloroplast) [Polygonatum sibiricum] ref|YP_009334427.1| ribosomal protein S18 (chloroplast) [Albuca kirkii] ref|YP_009334597.1| ribosomal protein S18 (chloroplast) [Beschorneria septentrionalis] ref|YP_009334683.1| ribosomal protein S18 (chloroplast) [Camassia scilloides] ref|YP_009334766.1| ribosomal protein S18 (chloroplast) [Chlorogalum pomeridianum] ref|YP_009335018.1| ribosomal protein S18 (chloroplast) [Hesperocallis undulata] ref|YP_009335355.1| ribosomal protein S18 (chloroplast) [Nolina atopocarpa] ref|YP_009335610.1| ribosomal protein S18 (chloroplast) [Yucca brevifolia] ref|YP_009335695.1| ribosomal protein S18 (chloroplast) [Yucca filamentosa] ref|YP_009335780.1| ribosomal protein S18 (chloroplast) [Yucca queretaroensis] ref|YP_009335865.1| ribosomal protein S18 (chloroplast) [Yucca schidigera] ref|YP_009370043.1| ribosomal protein S18 (chloroplast) [Asparagus officinalis] ref|YP_009409344.1| ribosomal protein S18 (chloroplast) [Aloe vera] ref|YP_009431154.1| ribosomal protein S18 (chloroplast) [Asparagus schoberioides] ref|YP_009431240.1| ribosomal protein S18 (chloroplast) [Maianthemum bicolor] ref|YP_009431411.1| ribosomal protein S18 (chloroplast) [Anthericum ramosum] ref|YP_009432325.1| ribosomal protein S18 (chloroplast) [Polygonatum stenophyllum] gb|AAZ03918.1| ribosomal protein S18, partial (chloroplast) [Yucca schidigera] gb|AEX94608.1| ribosomal protein S18 (chloroplast) [Camassia scilloides] gb|AEX94617.1| ribosomal protein S18 (chloroplast) [Amaryllis belladonna] gb|AEX94618.1| ribosomal protein S18 (chloroplast) [Crinum asiaticum] gb|AEX94620.1| ribosomal protein S18 (chloroplast) [Scadoxus cinnabarinus] gb|AEX94622.1| ribosomal protein S18 (chloroplast) [Asparagus officinalis] gb|AEX94623.1| ribosomal protein S18 (chloroplast) [Asparagus asparagoides] gb|AEX94625.1| ribosomal protein S18 (chloroplast) [Aloe vera] gb|AEX94628.1| ribosomal protein S18 (chloroplast) [Kniphofia linearifolia] gb|AEX94632.1| ribosomal protein S18 (chloroplast) [Drimia altissima] gb|AEX94634.1| ribosomal protein S18 (chloroplast) [Ornithogalum tenuifolium] gb|AEX94638.1| ribosomal protein S18 (chloroplast) [Beaucarnea hookeri] gb|AEX94639.1| ribosomal protein S18 (chloroplast) [Dasylirion wheeleri] gb|AEX94640.1| ribosomal protein S18 (chloroplast) [Eriospermum cervicorne] gb|AEX94642.1| ribosomal protein S18 (chloroplast) [Ophiopogon japonicus] gb|AEZ48796.1| ribosomal protein S18 (plastid) [Albuca kirkii] gb|ALM87759.1| ribosomal protein S18 (chloroplast) [Polygonatum verticillatum] gb|AMF84115.1| ribosomal protein S18 (chloroplast) [Polygonatum sibiricum] gb|APO11237.1| ribosomal protein S18 (chloroplast) [Albuca kirkii] gb|APO11408.1| ribosomal protein S18 (chloroplast) [Behnia reticulata] gb|APO11490.1| ribosomal protein S18 (chloroplast) [Beschorneria septentrionalis] gb|APO11576.1| ribosomal protein S18 (chloroplast) [Camassia scilloides] gb|APO11659.1| ribosomal protein S18 (chloroplast) [Chlorogalum pomeridianum] gb|APO12076.1| ribosomal protein S18 (chloroplast) [Hesperocallis undulata] gb|APO12413.1| ribosomal protein S18 (chloroplast) [Nolina atopocarpa] gb|APO12754.1| ribosomal protein S18 (chloroplast) [Yucca brevifolia] gb|APO12839.1| ribosomal protein S18 (chloroplast) [Yucca filamentosa] gb|APO12924.1| ribosomal protein S18 (chloroplast) [Yucca queretaroensis] gb|APO13009.1| ribosomal protein S18 (chloroplast) [Yucca schidigera] gb|APP88797.1| ribosomal protein S18 (chloroplast) [Aloe vera] gb|ARO91449.1| ribosomal protein S18 (chloroplast) [Asparagus officinalis] gb|ASW26590.1| ribosomal protein S18 (chloroplast) [Asparagus schoberioides] gb|ASW26676.1| ribosomal protein S18 (chloroplast) [Maianthemum bicolor] gb|ASW26847.1| ribosomal protein S18 (chloroplast) [Anthericum ramosum] gb|ATB18580.1| ribosomal protein S18 (chloroplast) [Polygonatum stenophyllum] emb|CUS18655.1| ribosomal protein S18 (plastid) [Asparagus officinalis] emb|CUS18736.1| ribosomal protein S18 (plastid) [Asparagus officinalis] Length = 101 Score = 155 bits (391), Expect = 1e-40 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >gb|AEX94646.1| ribosomal protein S18 (chloroplast) [Androstephium coeruleum] Length = 101 Score = 155 bits (391), Expect = 1e-40 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >gb|AEX94645.1| ribosomal protein S18 (chloroplast) [Maianthemum stellatum] Length = 101 Score = 155 bits (391), Expect = 1e-40 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >gb|AEX94633.1| ribosomal protein S18 (chloroplast) [Ledebouria cordifolia] Length = 101 Score = 155 bits (391), Expect = 1e-40 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >gb|AEX94627.1| ribosomal protein S18 (chloroplast) [Haworthia cymbiformis] Length = 101 Score = 155 bits (391), Expect = 1e-40 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >ref|YP_009045588.1| ribosomal protein S18 (chloroplast) [Cypripedium macranthos] ref|YP_009335186.1| ribosomal protein S18 (chloroplast) [Hosta ventricosa] ref|YP_009432663.1| ribosomal protein S18 (chloroplast) [Hosta minor] gb|AEX94610.1| ribosomal protein S18 (chloroplast) [Hosta ventricosa] gb|AHI16771.1| ribosomal protein S18 (chloroplast) (chloroplast) [Cypripedium macranthos] gb|APO12244.1| ribosomal protein S18 (chloroplast) [Hosta ventricosa] gb|ATB18892.1| ribosomal protein S18 (chloroplast) [Hosta minor] Length = 101 Score = 155 bits (391), Expect = 1e-40 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >gb|AEX94648.1| ribosomal protein S18 (chloroplast) [Dichelostemma capitatum] Length = 102 Score = 155 bits (391), Expect = 1e-40 Identities = 80/80 (100%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >ref|YP_009327326.1| ribosomal protein S18 (chloroplast) [Agave americana] ref|YP_009334341.1| ribosomal protein S18 (chloroplast) [Agave attenuata] ref|YP_009335269.1| ribosomal protein S18 (chloroplast) [Manfreda virginica] gb|AEX94611.1| ribosomal protein S18 (chloroplast) [Manfreda virginica] gb|AEX94612.1| ribosomal protein S18 (chloroplast) [Polianthes sp. Pires 2011-05] gb|AOV94060.1| ribosomal protein S18 (chloroplast) [Agave americana] gb|APO11151.1| ribosomal protein S18 (chloroplast) [Agave attenuata] gb|APO12327.1| ribosomal protein S18 (chloroplast) [Manfreda virginica] gb|APO12584.1| ribosomal protein S18 (chloroplast) [Polianthes sp. Pires 2011] Length = 101 Score = 154 bits (390), Expect = 2e-40 Identities = 79/80 (98%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAES+PRTTGPRTRNK Sbjct: 82 KQFERAESVPRTTGPRTRNK 101 >ref|YP_009409259.1| ribosomal protein S18 (chloroplast) [Aloe maculata] gb|APP88712.1| ribosomal protein S18 (chloroplast) [Aloe maculata] Length = 101 Score = 154 bits (388), Expect = 3e-40 Identities = 79/80 (98%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRR+NRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRMNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >ref|YP_009334850.1| ribosomal protein S18 (chloroplast) [Hesperaloe campanulata] ref|YP_009334934.1| ribosomal protein S18 (chloroplast) [Hesperaloe parviflora] ref|YP_009335101.1| ribosomal protein S18 (chloroplast) [Hesperoyucca whipplei] ref|YP_009335526.1| ribosomal protein S18 (chloroplast) [Schoenolirion croceum] gb|APO11908.1| ribosomal protein S18 (chloroplast) [Hesperaloe campanulata] gb|APO11992.1| ribosomal protein S18 (chloroplast) [Hesperaloe parviflora] gb|APO12159.1| ribosomal protein S18 (chloroplast) [Hesperoyucca whipplei] gb|APO12670.1| ribosomal protein S18 (chloroplast) [Schoenolirion croceum] Length = 101 Score = 154 bits (388), Expect = 3e-40 Identities = 79/80 (98%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFER+ESIPRTTGPRTRNK Sbjct: 82 KQFERSESIPRTTGPRTRNK 101 >gb|AEX94644.1| ribosomal protein S18 (chloroplast) [Sansevieria trifasciata] Length = 101 Score = 154 bits (388), Expect = 3e-40 Identities = 79/80 (98%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 +ESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 MESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >ref|YP_009229095.1| ribosomal protein S18 (chloroplast) [Iris sanguinea] gb|AEX94636.1| ribosomal protein S18 (chloroplast) [Iris tenax] gb|ALS46360.1| ribosomal protein S18 (chloroplast) [Iris sanguinea] Length = 101 Score = 154 bits (388), Expect = 3e-40 Identities = 79/80 (98%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVN+LTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNKLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >ref|YP_009431326.1| ribosomal protein S18 (chloroplast) [Agapanthus coddii] gb|AEX94606.1| ribosomal protein S18 (chloroplast) [Agapanthus africanus] gb|AEX94609.1| ribosomal protein S18 (chloroplast) [Echeandia sp. Steele 1101] gb|AEZ48795.1| ribosomal protein S18 (plastid) [Agapanthus praecox] gb|APO11825.1| ribosomal protein S18 (chloroplast) [Echeandia sp. Steele 1101] gb|ASW26762.1| ribosomal protein S18 (chloroplast) [Agapanthus coddii] Length = 101 Score = 154 bits (388), Expect = 3e-40 Identities = 79/80 (98%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRT+NK Sbjct: 82 KQFERAESIPRTTGPRTKNK 101 >gb|AEZ48815.1| ribosomal protein S18 (plastid) [Lomandra longifolia] Length = 101 Score = 153 bits (387), Expect = 5e-40 Identities = 79/80 (98%), Positives = 79/80 (98%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFER ESIPRTTGPRTRNK Sbjct: 82 KQFERTESIPRTTGPRTRNK 101 >ref|YP_009335440.1| ribosomal protein S18 (chloroplast) [Oziroe biflora] gb|AEX94635.1| ribosomal protein S18 (chloroplast) [Oziroe biflora] gb|APO12498.1| ribosomal protein S18 (chloroplast) [Oziroe biflora] Length = 101 Score = 153 bits (387), Expect = 5e-40 Identities = 79/80 (98%), Positives = 80/80 (100%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGD+IDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDQIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTRNK Sbjct: 82 KQFERAESIPRTTGPRTRNK 101 >gb|AEX94631.1| ribosomal protein S18 (chloroplast) [Bowiea volubilis] gb|AEX94641.1| ribosomal protein S18 (chloroplast) [Liriope spicata] Length = 101 Score = 153 bits (387), Expect = 5e-40 Identities = 79/80 (98%), Positives = 79/80 (98%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFER ESIPRTTGPRTRNK Sbjct: 82 KQFERVESIPRTTGPRTRNK 101 >ref|YP_009432410.1| ribosomal protein S18 (chloroplast) [Xanthorrhoea preissii] gb|AEX94652.1| ribosomal protein S18 (chloroplast) [Xanthorrhoea preissii] gb|ATB18665.1| ribosomal protein S18 (chloroplast) [Xanthorrhoea preissii] Length = 101 Score = 153 bits (386), Expect = 6e-40 Identities = 79/80 (98%), Positives = 79/80 (98%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRT GPRTRNK Sbjct: 82 KQFERAESIPRTNGPRTRNK 101 >gb|AEX94643.1| ribosomal protein S18 (chloroplast) [Ruscus aculeatus] Length = 101 Score = 153 bits (386), Expect = 6e-40 Identities = 79/80 (98%), Positives = 79/80 (98%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPR TGPRTRNK Sbjct: 82 KQFERAESIPRATGPRTRNK 101 >ref|YP_358601.1| hypothetical protein PhapfoPp052 [Phalaenopsis aphrodite subsp. formosana] gb|AAW82559.1| hypothetical protein (chloroplast) [Phalaenopsis aphrodite subsp. formosana] Length = 85 Score = 152 bits (384), Expect = 7e-40 Identities = 78/88 (88%), Positives = 80/88 (90%) Frame = -3 Query: 3049 LSLNSD*SFESMEEYIYLFLVLGPVVLGIDSALSNCFSLLRKGNKDKIRACFIAIVINRC 2870 +SL+SD SFE EYIYLFLVLGPVVLGIDS LSNCFSLLRKGNKDKIRACFIAIVINRC Sbjct: 1 MSLSSDWSFE---EYIYLFLVLGPVVLGIDSTLSNCFSLLRKGNKDKIRACFIAIVINRC 57 Query: 2869 CFKVNLFTRLDNIFPCSLINRLIKLMFL 2786 CFKVNLF RLD IFPCSL NRLIKLMFL Sbjct: 58 CFKVNLFVRLDKIFPCSLRNRLIKLMFL 85 >ref|YP_009432748.1| ribosomal protein S18 (chloroplast) [Milla biflora] gb|ATB19003.1| ribosomal protein S18 (chloroplast) [Milla biflora] Length = 101 Score = 152 bits (385), Expect = 9e-40 Identities = 79/80 (98%), Positives = 79/80 (98%) Frame = +3 Query: 2760 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 2939 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE Sbjct: 22 IESGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLNNE 81 Query: 2940 KQFERAESIPRTTGPRTRNK 2999 KQFERAESIPRTTGPRTR K Sbjct: 82 KQFERAESIPRTTGPRTRKK 101