BLASTX nr result
ID: Ophiopogon24_contig00010610
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00010610 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK56166.1| uncharacterized protein A4U43_C10F4820 [Asparagus... 65 3e-10 gb|ABC70707.1| MADS-box transcription factor [Asparagus virgatus] 65 1e-09 ref|XP_020247631.1| agamous-like MADS-box protein AGL9 homolog i... 65 1e-09 ref|XP_020247630.1| agamous-like MADS-box protein AGL9 homolog i... 65 1e-09 ref|XP_020247629.1| agamous-like MADS-box protein AGL9 homolog i... 65 1e-09 gb|AEX92976.1| MADS box protein 1 [Agave tequilana] 64 2e-09 gb|AGV31155.1| E-class MADS-box protein [Allium cepa] 64 4e-09 gb|ABC70706.1| MADS-box transcription factor [Asparagus virgatus] 63 7e-09 ref|XP_020261082.1| agamous-like MADS-box protein AGL9 homolog i... 61 4e-08 ref|XP_020261081.1| agamous-like MADS-box protein AGL9 homolog i... 61 4e-08 gb|AAR88773.1| MADS-box protein, partial [Musa acuminata AAA Group] 57 9e-08 gb|AIU94765.1| class E MADS-domain transcription factor, partial... 59 1e-07 gb|AAQ83836.1| MADS box protein [Asparagus officinalis] 57 6e-07 gb|ACB69509.1| SEPALLATA3-like MADS-box protein [Crocus sativus] 55 6e-06 >gb|ONK56166.1| uncharacterized protein A4U43_C10F4820 [Asparagus officinalis] Length = 152 Score = 64.7 bits (156), Expect = 3e-10 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +1 Query: 208 QANQQ-VLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQ V EAN NA+ Y+R +QPQGEEFFH LECQPT QIG Sbjct: 91 QANQQQVWEANANAMGYSRQPSQPQGEEFFHPLECQPTLQIG 132 >gb|ABC70707.1| MADS-box transcription factor [Asparagus virgatus] Length = 243 Score = 65.1 bits (157), Expect = 1e-09 Identities = 31/42 (73%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +1 Query: 208 QANQ-QVLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 Q NQ QV EAN NA+ YNR +QPQGEEFFH LECQPT QIG Sbjct: 182 QTNQRQVWEANANAMGYNRQPSQPQGEEFFHPLECQPTLQIG 223 >ref|XP_020247631.1| agamous-like MADS-box protein AGL9 homolog isoform X3 [Asparagus officinalis] Length = 228 Score = 64.7 bits (156), Expect = 1e-09 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +1 Query: 208 QANQQ-VLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQ V EAN NA+ Y+R +QPQGEEFFH LECQPT QIG Sbjct: 182 QANQQQVWEANANAMGYSRQPSQPQGEEFFHPLECQPTLQIG 223 >ref|XP_020247630.1| agamous-like MADS-box protein AGL9 homolog isoform X2 [Asparagus officinalis] Length = 240 Score = 64.7 bits (156), Expect = 1e-09 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +1 Query: 208 QANQQ-VLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQ V EAN NA+ Y+R +QPQGEEFFH LECQPT QIG Sbjct: 179 QANQQQVWEANANAMGYSRQPSQPQGEEFFHPLECQPTLQIG 220 >ref|XP_020247629.1| agamous-like MADS-box protein AGL9 homolog isoform X1 [Asparagus officinalis] gb|ABC70710.1| MADS-box transcription factor [Asparagus officinalis] Length = 243 Score = 64.7 bits (156), Expect = 1e-09 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +1 Query: 208 QANQQ-VLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQ V EAN NA+ Y+R +QPQGEEFFH LECQPT QIG Sbjct: 182 QANQQQVWEANANAMGYSRQPSQPQGEEFFHPLECQPTLQIG 223 >gb|AEX92976.1| MADS box protein 1 [Agave tequilana] Length = 243 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +1 Query: 208 QANQQVLEANVNA-IAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQV EAN NA + Y+R NQPQG+EFFH LECQPT Q+G Sbjct: 182 QANQQVWEANPNAMVGYSRQPNQPQGDEFFHPLECQPTLQMG 223 >gb|AGV31155.1| E-class MADS-box protein [Allium cepa] Length = 240 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/42 (71%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +1 Query: 208 QANQQ-VLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQ V EAN NA+ Y R NQPQGE+FFH LECQPT Q+G Sbjct: 179 QANQQQVWEANANAMGYARQQNQPQGEDFFHPLECQPTLQMG 220 >gb|ABC70706.1| MADS-box transcription factor [Asparagus virgatus] Length = 239 Score = 62.8 bits (151), Expect = 7e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 208 QANQQVLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQ + + NA+ YNR NQPQG++FFH LECQPT QIG Sbjct: 179 QANQQQVWEDANAMGYNRQPNQPQGDQFFHPLECQPTLQIG 219 >ref|XP_020261082.1| agamous-like MADS-box protein AGL9 homolog isoform X2 [Asparagus officinalis] gb|AAQ83834.1| MADS box protein [Asparagus officinalis] gb|ABC70709.1| MADS-box transcription factor [Asparagus officinalis] Length = 239 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 208 QANQQVLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQ + + NA+ YNR NQP G++FFH LECQPT QIG Sbjct: 179 QANQQQVWEDANAMGYNRQPNQPHGDQFFHPLECQPTLQIG 219 >ref|XP_020261081.1| agamous-like MADS-box protein AGL9 homolog isoform X1 [Asparagus officinalis] Length = 242 Score = 60.8 bits (146), Expect = 4e-08 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 208 QANQQVLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQ + + NA+ YNR NQP G++FFH LECQPT QIG Sbjct: 182 QANQQQVWEDANAMGYNRQPNQPHGDQFFHPLECQPTLQIG 222 >gb|AAR88773.1| MADS-box protein, partial [Musa acuminata AAA Group] Length = 80 Score = 56.6 bits (135), Expect = 9e-08 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = +1 Query: 208 QANQQVLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QANQQ ++N A+AY RH QPQG+ FF +EC+PT QIG Sbjct: 16 QANQQQWDSNAQAVAYCRHQPQPQGDGFFQPIECEPTLQIG 56 >gb|AIU94765.1| class E MADS-domain transcription factor, partial [Hypoxis villosa] Length = 218 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +1 Query: 214 NQQVLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 +QQV E+N NA+ Y R Q QGEEFFH LECQPT QIG Sbjct: 160 HQQVWESNANALGYGRQPTQQQGEEFFHPLECQPTLQIG 198 >gb|AAQ83836.1| MADS box protein [Asparagus officinalis] Length = 224 Score = 57.4 bits (137), Expect = 6e-07 Identities = 27/38 (71%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = +1 Query: 208 QANQQ-VLEANVNAIAYNRHSNQPQGEEFFHSLECQPT 318 QANQQ V EAN NA+ Y+R +QPQGEEFFH LECQP+ Sbjct: 182 QANQQQVWEANANAMGYSRQPSQPQGEEFFHPLECQPS 219 >gb|ACB69509.1| SEPALLATA3-like MADS-box protein [Crocus sativus] Length = 238 Score = 54.7 bits (130), Expect = 6e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 208 QANQQVLEANVNAIAYNRHSNQPQGEEFFHSLECQPTFQIG 330 QA+QQV E+N NAIAY R +NQ Q EEF+ L+CQPT QIG Sbjct: 179 QAHQQVWESNANAIAYARQANQ-QEEEFYQPLDCQPTLQIG 218