BLASTX nr result
ID: Ophiopogon24_contig00010608
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00010608 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK70502.1| uncharacterized protein A4U43_C05F34370 [Asparagu... 135 2e-38 ref|XP_020265816.1| phosphatidylinositol/phosphatidylcholine tra... 134 1e-37 gb|PKI59497.1| hypothetical protein CRG98_020128, partial [Punic... 132 1e-36 gb|PON65137.1| hypothetical protein PanWU01x14_118430 [Parasponi... 126 4e-34 gb|ONK81270.1| uncharacterized protein A4U43_C01F27220 [Asparagu... 134 4e-34 ref|XP_020251535.1| phosphatidylinositol/phosphatidylcholine tra... 134 4e-34 ref|XP_020251533.1| phosphatidylinositol/phosphatidylcholine tra... 134 5e-34 ref|XP_021864250.1| phosphatidylinositol/phosphatidylcholine tra... 133 9e-34 ref|XP_021864251.1| phosphatidylinositol/phosphatidylcholine tra... 132 2e-33 ref|XP_021892315.1| LOW QUALITY PROTEIN: phosphatidylinositol/ph... 130 8e-33 ref|XP_019413568.1| PREDICTED: phosphatidylinositol/phosphatidyl... 129 2e-32 ref|XP_018438978.1| PREDICTED: phosphatidylinositol/phosphatidyl... 129 2e-32 ref|XP_018438977.1| PREDICTED: phosphatidylinositol/phosphatidyl... 129 2e-32 ref|XP_019413569.1| PREDICTED: phosphatidylinositol/phosphatidyl... 129 4e-32 ref|XP_013660949.1| phosphatidylinositol/phosphatidylcholine tra... 128 6e-32 ref|XP_013604617.1| PREDICTED: phosphatidylinositol/phosphatidyl... 128 6e-32 emb|CDY13810.1| BnaA09g43120D [Brassica napus] 128 6e-32 ref|XP_013706592.1| phosphatidylinositol/phosphatidylcholine tra... 128 6e-32 ref|XP_009117393.1| PREDICTED: phosphatidylinositol/phosphatidyl... 128 6e-32 ref|XP_013660948.1| phosphatidylinositol/phosphatidylcholine tra... 128 6e-32 >gb|ONK70502.1| uncharacterized protein A4U43_C05F34370 [Asparagus officinalis] Length = 143 Score = 135 bits (341), Expect = 2e-38 Identities = 70/83 (84%), Positives = 75/83 (90%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRLGELEEKV +LQAKPSEMP EKEELLNAAVCRVDALEAELI+TK ALHE LMRQEELL Sbjct: 64 KRLGELEEKVGDLQAKPSEMPPEKEELLNAAVCRVDALEAELITTKKALHEVLMRQEELL 123 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQQE KFQK KK+++CF Sbjct: 124 AYIDRQQEVKFQK---KKRMLCF 143 >ref|XP_020265816.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Asparagus officinalis] Length = 143 Score = 134 bits (336), Expect = 1e-37 Identities = 69/83 (83%), Positives = 75/83 (90%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRLGELEEKV +LQAKPSEMP EKEELLNAAVCRVDALEAELI+TK ALHE LMRQEELL Sbjct: 64 KRLGELEEKVGDLQAKPSEMPPEKEELLNAAVCRVDALEAELITTKKALHEVLMRQEELL 123 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQQE KLQ+KK+++CF Sbjct: 124 AYIDRQQEV---KLQKKKRMLCF 143 >gb|PKI59497.1| hypothetical protein CRG98_020128, partial [Punica granatum] Length = 166 Score = 132 bits (331), Expect = 1e-36 Identities = 70/83 (84%), Positives = 73/83 (87%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRLGELEEKVD LQAKPSEMP EKEELLNAAVCRVDALEAELI+TK ALHEALMRQEELL Sbjct: 88 KRLGELEEKVDTLQAKPSEMPYEKEELLNAAVCRVDALEAELIATKKALHEALMRQEELL 147 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYID Q+EAKF RKKK C+ Sbjct: 148 AYIDSQEEAKF----RKKKFFCW 166 >gb|PON65137.1| hypothetical protein PanWU01x14_118430 [Parasponia andersonii] Length = 192 Score = 126 bits (317), Expect = 4e-34 Identities = 64/73 (87%), Positives = 70/73 (95%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRLGELEEKVD LQ+KPSEMPSEKEELLNAAVCRVDALEAELI+TK AL+EALM+QEELL Sbjct: 115 KRLGELEEKVDTLQSKPSEMPSEKEELLNAAVCRVDALEAELIATKKALYEALMKQEELL 174 Query: 183 AYIDRQQEAKFQK 221 AYIDRQ+EA+ QK Sbjct: 175 AYIDRQEEARLQK 187 >gb|ONK81270.1| uncharacterized protein A4U43_C01F27220 [Asparagus officinalis] Length = 593 Score = 134 bits (337), Expect = 4e-34 Identities = 70/83 (84%), Positives = 75/83 (90%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRLGELEEKVDELQAKP EMP+EKEELLNAAV RVDALEAELI+TK LHEALMRQEELL Sbjct: 513 KRLGELEEKVDELQAKPCEMPTEKEELLNAAVRRVDALEAELITTKKTLHEALMRQEELL 572 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQQ AKFQK + KK++CF Sbjct: 573 AYIDRQQNAKFQK--KNKKMVCF 593 >ref|XP_020251535.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH6-like isoform X2 [Asparagus officinalis] Length = 627 Score = 134 bits (337), Expect = 4e-34 Identities = 70/83 (84%), Positives = 75/83 (90%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRLGELEEKVDELQAKP EMP+EKEELLNAAV RVDALEAELI+TK LHEALMRQEELL Sbjct: 547 KRLGELEEKVDELQAKPCEMPTEKEELLNAAVRRVDALEAELITTKKTLHEALMRQEELL 606 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQQ AKFQK + KK++CF Sbjct: 607 AYIDRQQNAKFQK--KNKKMVCF 627 >ref|XP_020251533.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH6-like isoform X1 [Asparagus officinalis] ref|XP_020251534.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH6-like isoform X1 [Asparagus officinalis] Length = 637 Score = 134 bits (337), Expect = 5e-34 Identities = 70/83 (84%), Positives = 75/83 (90%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRLGELEEKVDELQAKP EMP+EKEELLNAAV RVDALEAELI+TK LHEALMRQEELL Sbjct: 557 KRLGELEEKVDELQAKPCEMPTEKEELLNAAVRRVDALEAELITTKKTLHEALMRQEELL 616 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQQ AKFQK + KK++CF Sbjct: 617 AYIDRQQNAKFQK--KNKKMVCF 637 >ref|XP_021864250.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH6-like isoform X1 [Spinacia oleracea] gb|KNA10368.1| hypothetical protein SOVF_145030 isoform A [Spinacia oleracea] Length = 637 Score = 133 bits (335), Expect = 9e-34 Identities = 69/83 (83%), Positives = 75/83 (90%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRLGELEEKVD LQ+KPSEMP EKEELLNAAVCRVDALEAELI+TK ALHEALMRQEELL Sbjct: 557 KRLGELEEKVDTLQSKPSEMPYEKEELLNAAVCRVDALEAELIATKKALHEALMRQEELL 616 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+ KFQ Q+KKK+ C+ Sbjct: 617 AYIDRQEAVKFQ--QKKKKMFCW 637 >ref|XP_021864251.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH6-like isoform X2 [Spinacia oleracea] gb|KNA10369.1| hypothetical protein SOVF_145030 isoform B [Spinacia oleracea] Length = 636 Score = 132 bits (332), Expect = 2e-33 Identities = 69/83 (83%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRLGELEEKVD LQ+KPSEMP EKEELLNAAVCRVDALEAELI+TK ALHEALMRQEELL Sbjct: 557 KRLGELEEKVDTLQSKPSEMPYEKEELLNAAVCRVDALEAELIATKKALHEALMRQEELL 616 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+ KFQK KKK+ C+ Sbjct: 617 AYIDRQEAVKFQK---KKKMFCW 636 >ref|XP_021892315.1| LOW QUALITY PROTEIN: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like [Carica papaya] Length = 532 Score = 130 bits (326), Expect = 8e-33 Identities = 69/83 (83%), Positives = 73/83 (87%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRL ELEEKVD LQ+KPSEMP EKEELLNAAVCRVDALEAELI+TK ALHEALMRQEELL Sbjct: 454 KRLNELEEKVDTLQSKPSEMPYEKEELLNAAVCRVDALEAELIATKKALHEALMRQEELL 513 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EAKF RKKK C+ Sbjct: 514 AYIDRQEEAKF----RKKKKFCW 532 >ref|XP_019413568.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like isoform X1 [Lupinus angustifolius] Length = 630 Score = 129 bits (325), Expect = 2e-32 Identities = 68/83 (81%), Positives = 75/83 (90%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRL ELEEKVD LQ+KPSEMP+EK ELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 551 KRLSELEEKVDTLQSKPSEMPNEKAELLNAAVCRVDALEAELIATKKALYEALMRQEELL 610 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EAKF+K KKKL C+ Sbjct: 611 AYIDRQEEAKFRK---KKKLFCW 630 >ref|XP_018438978.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8 isoform X2 [Raphanus sativus] Length = 634 Score = 129 bits (325), Expect = 2e-32 Identities = 64/83 (77%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 K+L ELE K+ LQ KP+EMP EKEELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 552 KKLNELEGKIGTLQTKPNEMPCEKEELLNAAVCRVDALEAELIATKKALYEALMRQEELL 611 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EA+FQK+++KK L CF Sbjct: 612 AYIDRQEEAQFQKMKKKKHLFCF 634 >ref|XP_018438977.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8 isoform X1 [Raphanus sativus] Length = 638 Score = 129 bits (325), Expect = 2e-32 Identities = 64/83 (77%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 K+L ELE K+ LQ KP+EMP EKEELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 556 KKLNELEGKIGTLQTKPNEMPCEKEELLNAAVCRVDALEAELIATKKALYEALMRQEELL 615 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EA+FQK+++KK L CF Sbjct: 616 AYIDRQEEAQFQKMKKKKHLFCF 638 >ref|XP_019413569.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like isoform X2 [Lupinus angustifolius] Length = 629 Score = 129 bits (323), Expect = 4e-32 Identities = 68/83 (81%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 KRL ELEEKVD LQ+KPSEMP+EK ELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 551 KRLSELEEKVDTLQSKPSEMPNEKAELLNAAVCRVDALEAELIATKKALYEALMRQEELL 610 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EAKF RKKKL C+ Sbjct: 611 AYIDRQEEAKF----RKKKLFCW 629 >ref|XP_013660949.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH8 isoform X2 [Brassica napus] Length = 632 Score = 128 bits (322), Expect = 6e-32 Identities = 64/83 (77%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 K+L ELE K+ LQ KP+EMP EKEELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 550 KKLTELEGKIGTLQTKPNEMPYEKEELLNAAVCRVDALEAELIATKKALYEALMRQEELL 609 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EA+FQK+++KK L CF Sbjct: 610 AYIDRQEEAQFQKMKKKKHLFCF 632 >ref|XP_013604617.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8 isoform X2 [Brassica oleracea var. oleracea] Length = 632 Score = 128 bits (322), Expect = 6e-32 Identities = 64/83 (77%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 K+L ELE K+ LQ KP+EMP EKEELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 550 KKLTELEGKIGTLQTKPNEMPYEKEELLNAAVCRVDALEAELIATKKALYEALMRQEELL 609 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EA+FQK+++KK L CF Sbjct: 610 AYIDRQEEAQFQKMKKKKHLFCF 632 >emb|CDY13810.1| BnaA09g43120D [Brassica napus] Length = 632 Score = 128 bits (322), Expect = 6e-32 Identities = 64/83 (77%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 K+L ELE K+ LQ KP+EMP EKEELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 550 KKLTELEGKIGTLQTKPNEMPYEKEELLNAAVCRVDALEAELIATKKALYEALMRQEELL 609 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EA+FQK+++KK L CF Sbjct: 610 AYIDRQEEAQFQKMKKKKHLFCF 632 >ref|XP_013706592.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH8-like isoform X2 [Brassica napus] Length = 634 Score = 128 bits (322), Expect = 6e-32 Identities = 64/83 (77%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 K+L ELE K+ LQ KP+EMP EKEELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 552 KKLTELEGKIGTLQTKPNEMPYEKEELLNAAVCRVDALEAELIATKKALYEALMRQEELL 611 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EA+FQK+++KK L CF Sbjct: 612 AYIDRQEEAQFQKMKKKKHLFCF 634 >ref|XP_009117393.1| PREDICTED: phosphatidylinositol/phosphatidylcholine transfer protein SFH8 isoform X2 [Brassica rapa] Length = 634 Score = 128 bits (322), Expect = 6e-32 Identities = 64/83 (77%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 K+L ELE K+ LQ KP+EMP EKEELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 552 KKLTELEGKIGTLQTKPNEMPYEKEELLNAAVCRVDALEAELIATKKALYEALMRQEELL 611 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EA+FQK+++KK L CF Sbjct: 612 AYIDRQEEAQFQKMKKKKHLFCF 634 >ref|XP_013660948.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH8 isoform X1 [Brassica napus] Length = 636 Score = 128 bits (322), Expect = 6e-32 Identities = 64/83 (77%), Positives = 74/83 (89%) Frame = +3 Query: 3 KRLGELEEKVDELQAKPSEMPSEKEELLNAAVCRVDALEAELISTKMALHEALMRQEELL 182 K+L ELE K+ LQ KP+EMP EKEELLNAAVCRVDALEAELI+TK AL+EALMRQEELL Sbjct: 554 KKLTELEGKIGTLQTKPNEMPYEKEELLNAAVCRVDALEAELIATKKALYEALMRQEELL 613 Query: 183 AYIDRQQEAKFQKLQRKKKLICF 251 AYIDRQ+EA+FQK+++KK L CF Sbjct: 614 AYIDRQEEAQFQKMKKKKHLFCF 636