BLASTX nr result
ID: Ophiopogon24_contig00010404
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00010404 (565 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK58481.1| uncharacterized protein A4U43_C09F13490 [Asparagu... 55 1e-05 >gb|ONK58481.1| uncharacterized protein A4U43_C09F13490 [Asparagus officinalis] Length = 306 Score = 55.5 bits (132), Expect = 1e-05 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 472 EVDAEKPEIDPEVLALKEMIESQKKNAVEGD 564 EVDA+KPEIDPE LALKEMIE+QKKNA E D Sbjct: 139 EVDAKKPEIDPEALALKEMIEAQKKNAAEAD 169