BLASTX nr result
ID: Ophiopogon24_contig00010356
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00010356 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006647037.1| PREDICTED: putative F-box protein At2g02030 ... 55 4e-06 >ref|XP_006647037.1| PREDICTED: putative F-box protein At2g02030 [Oryza brachyantha] ref|XP_015688370.1| PREDICTED: putative F-box protein At2g02030 [Oryza brachyantha] Length = 430 Score = 54.7 bits (130), Expect = 4e-06 Identities = 32/83 (38%), Positives = 46/83 (55%) Frame = -3 Query: 249 KEQSLVDLHLERARGAFPPSVLIFSKSYSEANVNLALLDNDWVPKYSYQLPVGSGRYHMT 70 KE + VDLHL+ A F S+ F+ S + + + D V + PV S R+HM+ Sbjct: 52 KEPAFVDLHLDNAL-RFHQSIACFT-SVDNGLIQMYMFDPTTV-NFKRTEPVFSSRFHMS 108 Query: 69 ASCNGIVCIYDDNGYVQLLNPTT 1 CNG++C YD G ++LNPTT Sbjct: 109 EPCNGMMCAYDLKGGAEVLNPTT 131