BLASTX nr result
ID: Ophiopogon24_contig00010260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00010260 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010532033.1| PREDICTED: acyl-acyl carrier protein thioest... 85 2e-17 gb|OMP10038.1| putative acyl-CoA thioesterase [Corchorus olitorius] 84 3e-17 gb|OMO63532.1| putative acyl-CoA thioesterase [Corchorus capsula... 84 5e-17 ref|XP_020248795.1| acyl-acyl carrier protein thioesterase ATL3,... 83 7e-17 ref|XP_021298863.1| acyl-acyl carrier protein thioesterase ATL3,... 82 2e-16 ref|XP_012082110.1| acyl-acyl carrier protein thioesterase ATL3,... 82 2e-16 ref|XP_006468713.1| PREDICTED: acyl-acyl carrier protein thioest... 81 3e-16 ref|XP_006448453.1| acyl-acyl carrier protein thioesterase ATL3,... 81 3e-16 gb|PON78637.1| Thioesterase domain containing protein [Parasponi... 81 4e-16 ref|XP_022726471.1| acyl-acyl carrier protein thioesterase ATL3,... 81 4e-16 ref|XP_017216257.1| PREDICTED: acyl-acyl carrier protein thioest... 81 5e-16 gb|PKI60389.1| hypothetical protein CRG98_019214 [Punica granatum] 79 6e-16 gb|KZM86517.1| hypothetical protein DCAR_023651 [Daucus carota s... 81 7e-16 ref|XP_010681488.1| PREDICTED: acyl-acyl carrier protein thioest... 80 8e-16 emb|CDP00639.1| unnamed protein product [Coffea canephora] 80 9e-16 ref|XP_023746319.1| acyl-acyl carrier protein thioesterase ATL3,... 80 1e-15 ref|XP_024023248.1| acyl-acyl carrier protein thioesterase ATL3,... 80 1e-15 gb|KJB76882.1| hypothetical protein B456_012G122200 [Gossypium r... 78 1e-15 gb|PIN22061.1| hypothetical protein CDL12_05220 [Handroanthus im... 80 1e-15 ref|XP_008339658.1| PREDICTED: acyl-acyl carrier protein thioest... 80 1e-15 >ref|XP_010532033.1| PREDICTED: acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Tarenaya hassleriana] ref|XP_010532043.1| PREDICTED: acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Tarenaya hassleriana] Length = 207 Score = 84.7 bits (208), Expect = 2e-17 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKLSLL 282 RI++EHFI+KLP+ EPILEAKATAVWLD+NYRPVRIPPD RSK LL Sbjct: 154 RIYVEHFIYKLPNQEPILEAKATAVWLDKNYRPVRIPPDIRSKFVLL 200 >gb|OMP10038.1| putative acyl-CoA thioesterase [Corchorus olitorius] Length = 182 Score = 83.6 bits (205), Expect = 3e-17 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSK 294 RI+ EHFIFKLP+ EP+LEAKATAVWLD+NYRPVRIPP+FRSK Sbjct: 129 RIYFEHFIFKLPNEEPVLEAKATAVWLDKNYRPVRIPPEFRSK 171 >gb|OMO63532.1| putative acyl-CoA thioesterase [Corchorus capsularis] Length = 217 Score = 83.6 bits (205), Expect = 5e-17 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSK 294 RI+ EHFIFKLP+ EP+LEAKATAVWLD+NYRPVRIPP+FRSK Sbjct: 164 RIYFEHFIFKLPNEEPVLEAKATAVWLDKNYRPVRIPPEFRSK 206 >ref|XP_020248795.1| acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Asparagus officinalis] ref|XP_020248796.1| acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Asparagus officinalis] gb|ONK56291.1| uncharacterized protein A4U43_C10F6210 [Asparagus officinalis] Length = 212 Score = 83.2 bits (204), Expect = 7e-17 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKLSLLD 279 RIFMEH IFKLPD++ ILEA ATAVWLD++YRP+RIPPDFR+KL+ LD Sbjct: 163 RIFMEHLIFKLPDNQLILEANATAVWLDKSYRPIRIPPDFRTKLAQLD 210 >ref|XP_021298863.1| acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Herrania umbratica] Length = 202 Score = 81.6 bits (200), Expect = 2e-16 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSK 294 R++ EHFIFKLP+ EPILEAKATAVWLD+NYRPVRIPP+FRSK Sbjct: 149 RMYFEHFIFKLPNLEPILEAKATAVWLDKNYRPVRIPPEFRSK 191 >ref|XP_012082110.1| acyl-acyl carrier protein thioesterase ATL3, chloroplastic isoform X1 [Jatropha curcas] gb|KDP29426.1| hypothetical protein JCGZ_18347 [Jatropha curcas] Length = 210 Score = 81.6 bits (200), Expect = 2e-16 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKL 291 R++ +HFIFKLP EPILEAKATAVWLD+NYRPVRIP DFRSKL Sbjct: 157 RLYFDHFIFKLPSEEPILEAKATAVWLDKNYRPVRIPSDFRSKL 200 >ref|XP_006468713.1| PREDICTED: acyl-acyl carrier protein thioesterase ATL3, chloroplastic [Citrus sinensis] gb|KDO76972.1| hypothetical protein CISIN_1g028735mg [Citrus sinensis] Length = 204 Score = 81.3 bits (199), Expect = 3e-16 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKLS 288 R+ +HFIFKLP+HEPILEAK TAVWLD+NYRPVRIPP+ RSK++ Sbjct: 151 RLIFDHFIFKLPNHEPILEAKGTAVWLDKNYRPVRIPPEMRSKIA 195 >ref|XP_006448453.1| acyl-acyl carrier protein thioesterase ATL3, chloroplastic [Citrus clementina] gb|ESR61693.1| hypothetical protein CICLE_v10016740mg [Citrus clementina] dbj|GAY47550.1| hypothetical protein CUMW_105280 [Citrus unshiu] Length = 204 Score = 81.3 bits (199), Expect = 3e-16 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKLS 288 R+ +HFIFKLP+HEPILEAK TAVWLD+NYRPVRIPP+ RSK++ Sbjct: 151 RLIFDHFIFKLPNHEPILEAKGTAVWLDKNYRPVRIPPEMRSKIA 195 >gb|PON78637.1| Thioesterase domain containing protein [Parasponia andersonii] Length = 205 Score = 80.9 bits (198), Expect = 4e-16 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKL 291 R++ EHFIFKLP+ EPILEAKATAVWLD+NYRPVRIPP+ RSKL Sbjct: 153 RLYFEHFIFKLPNLEPILEAKATAVWLDKNYRPVRIPPEVRSKL 196 >ref|XP_022726471.1| acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Durio zibethinus] Length = 206 Score = 80.9 bits (198), Expect = 4e-16 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSK 294 R++ EHFIFKLP+ EPILEAKATAVWLD+NY PVRIPP+FRSK Sbjct: 153 RMYFEHFIFKLPNEEPILEAKATAVWLDKNYHPVRIPPEFRSK 195 >ref|XP_017216257.1| PREDICTED: acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like isoform X1 [Daucus carota subsp. sativus] Length = 211 Score = 80.9 bits (198), Expect = 5e-16 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKLSLLDPNSE 267 R++ EH IFKLPD EPILEA+ATAVWLD+NYRPVRIPP+ RSKL +SE Sbjct: 158 RLYFEHLIFKLPDQEPILEARATAVWLDKNYRPVRIPPEVRSKLVQFIRHSE 209 >gb|PKI60389.1| hypothetical protein CRG98_019214 [Punica granatum] Length = 141 Score = 79.0 bits (193), Expect = 6e-16 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKL 291 RI++ HFI+KLP+ EPILEAKATAVWLD+NYRPVRIPP+ RSKL Sbjct: 88 RIYINHFIYKLPNLEPILEAKATAVWLDKNYRPVRIPPEVRSKL 131 >gb|KZM86517.1| hypothetical protein DCAR_023651 [Daucus carota subsp. sativus] Length = 234 Score = 80.9 bits (198), Expect = 7e-16 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKLSLLDPNSE 267 R++ EH IFKLPD EPILEA+ATAVWLD+NYRPVRIPP+ RSKL +SE Sbjct: 181 RLYFEHLIFKLPDQEPILEARATAVWLDKNYRPVRIPPEVRSKLVQFIRHSE 232 >ref|XP_010681488.1| PREDICTED: acyl-acyl carrier protein thioesterase ATL3, chloroplastic [Beta vulgaris subsp. vulgaris] ref|XP_010681489.1| PREDICTED: acyl-acyl carrier protein thioesterase ATL3, chloroplastic [Beta vulgaris subsp. vulgaris] gb|KMT08323.1| hypothetical protein BVRB_6g141470 [Beta vulgaris subsp. vulgaris] Length = 218 Score = 80.5 bits (197), Expect = 8e-16 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKLS 288 R F +HFI+KLP+ EPILEAKATAVWLD+NYRPVRIPP+ RSKL+ Sbjct: 165 RFFFDHFIYKLPNEEPILEAKATAVWLDKNYRPVRIPPEVRSKLT 209 >emb|CDP00639.1| unnamed protein product [Coffea canephora] Length = 204 Score = 80.1 bits (196), Expect = 9e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKLSL 285 R+F EHFIFKLP+ EPILEAKATAVWLD++YRPVRIP D RSK +L Sbjct: 151 RLFFEHFIFKLPNEEPILEAKATAVWLDKSYRPVRIPADVRSKFNL 196 >ref|XP_023746319.1| acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Lactuca sativa] gb|PLY64334.1| hypothetical protein LSAT_4X15820 [Lactuca sativa] Length = 210 Score = 80.1 bits (196), Expect = 1e-15 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKL 291 RI+ EHFIFK+P+ EPILEA+ATAVWLD+NYRP+R+PP+ RSKL Sbjct: 157 RIYFEHFIFKIPNQEPILEARATAVWLDKNYRPIRVPPEVRSKL 200 >ref|XP_024023248.1| acyl-acyl carrier protein thioesterase ATL3, chloroplastic [Morus notabilis] Length = 214 Score = 80.1 bits (196), Expect = 1e-15 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKL 291 R++ EH IFKLP+ EPILEAKATAVWLD+NYRPVRIPP+ RSKL Sbjct: 161 RLYFEHLIFKLPNQEPILEAKATAVWLDKNYRPVRIPPEMRSKL 204 >gb|KJB76882.1| hypothetical protein B456_012G122200 [Gossypium raimondii] Length = 138 Score = 78.2 bits (191), Expect = 1e-15 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSK 294 R++ EHFIFK+P+ PILEAKATAVWLD+NYRP RIPP+FRSK Sbjct: 85 RLYFEHFIFKMPNEVPILEAKATAVWLDKNYRPARIPPEFRSK 127 >gb|PIN22061.1| hypothetical protein CDL12_05220 [Handroanthus impetiginosus] Length = 208 Score = 79.7 bits (195), Expect = 1e-15 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKL 291 R+F EHFIFK+P+ EPILEA+ATAVWLD+NY PVRIPPD RSKL Sbjct: 155 RLFFEHFIFKIPNLEPILEARATAVWLDKNYHPVRIPPDVRSKL 198 >ref|XP_008339658.1| PREDICTED: acyl-acyl carrier protein thioesterase ATL3, chloroplastic-like [Malus domestica] Length = 209 Score = 79.7 bits (195), Expect = 1e-15 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -3 Query: 422 RIFMEHFIFKLPDHEPILEAKATAVWLDRNYRPVRIPPDFRSKL 291 R++ +HFIFKLP+ EPILEAKATAVWLD+NYRPVRIPP+ +SKL Sbjct: 156 RLYFDHFIFKLPNQEPILEAKATAVWLDKNYRPVRIPPEVKSKL 199