BLASTX nr result
ID: Ophiopogon24_contig00009885
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00009885 (588 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262098.1| F-box protein SKP2A-like isoform X1 [Asparag... 59 6e-07 >ref|XP_020262098.1| F-box protein SKP2A-like isoform X1 [Asparagus officinalis] gb|ONK73271.1| uncharacterized protein A4U43_C04F29200 [Asparagus officinalis] Length = 372 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 497 MVGGRPVTGNLDFWFRNLMVADGRGQMDGV 586 MVGGRPVTGNLDFWFRNLMVADG +M+GV Sbjct: 1 MVGGRPVTGNLDFWFRNLMVADGAEKMEGV 30