BLASTX nr result
ID: Ophiopogon24_contig00009741
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00009741 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253351.1| zinc finger CCCH domain-containing protein 6... 101 2e-22 gb|ONK77689.1| uncharacterized protein A4U43_C02F9500 [Asparagus... 101 2e-22 gb|ORX45868.1| hypothetical protein DM01DRAFT_1349225 [Hesseltin... 54 7e-06 ref|XP_021334191.1| protein bassoon isoform X2 [Danio rerio] 54 8e-06 ref|XP_001920788.3| protein bassoon isoform X1 [Danio rerio] 54 8e-06 >ref|XP_020253351.1| zinc finger CCCH domain-containing protein 65-like [Asparagus officinalis] Length = 596 Score = 101 bits (252), Expect = 2e-22 Identities = 45/89 (50%), Positives = 63/89 (70%) Frame = +1 Query: 130 EQSDEVKADGWGWDQDFTAPEGNQKFEENPEWTSEEKVEAWGWDQETGGSEESAKGDMCS 309 ++ DEV ADGWGWDQDF GNQ E++ EW++ EKVE +GW ETG +E++ K + Sbjct: 134 QKPDEVMADGWGWDQDFNLSNGNQNPEKDIEWSNGEKVEVFGWGPETGVTEKNYKPGVGF 193 Query: 310 ESWKEEKGQLRRSPFPQRPNELDCSFFVK 396 E+ KEEKGQ R+ FP R NE +C++++K Sbjct: 194 ENTKEEKGQRRKPQFPVRSNEANCAYYMK 222 >gb|ONK77689.1| uncharacterized protein A4U43_C02F9500 [Asparagus officinalis] Length = 814 Score = 101 bits (252), Expect = 2e-22 Identities = 45/89 (50%), Positives = 63/89 (70%) Frame = +1 Query: 130 EQSDEVKADGWGWDQDFTAPEGNQKFEENPEWTSEEKVEAWGWDQETGGSEESAKGDMCS 309 ++ DEV ADGWGWDQDF GNQ E++ EW++ EKVE +GW ETG +E++ K + Sbjct: 134 QKPDEVMADGWGWDQDFNLSNGNQNPEKDIEWSNGEKVEVFGWGPETGVTEKNYKPGVGF 193 Query: 310 ESWKEEKGQLRRSPFPQRPNELDCSFFVK 396 E+ KEEKGQ R+ FP R NE +C++++K Sbjct: 194 ENTKEEKGQRRKPQFPVRSNEANCAYYMK 222 >gb|ORX45868.1| hypothetical protein DM01DRAFT_1349225 [Hesseltinella vesiculosa] Length = 441 Score = 54.3 bits (129), Expect = 7e-06 Identities = 35/85 (41%), Positives = 45/85 (52%) Frame = -3 Query: 259 PIPKPLPSLHSSTQDSPQISDSLQAQ*NLDPNPIHLPSLHQTAPDPSPASHPHQPKHLLD 80 P P+P S+ SS +S SLQ Q L P H P++ + PSP HPH P HL Sbjct: 242 PSPQPPSSVSSSLNT---LSSSLQHQLYLTPK--HRPNMLR---HPSPHHHPHPPHHLPP 293 Query: 79 PSPQASGLQPQQLLHPCPHASPLQP 5 P+PQ+ Q Q +HP H+SP P Sbjct: 294 PTPQSPLHQQPQPMHPPHHSSPSTP 318 >ref|XP_021334191.1| protein bassoon isoform X2 [Danio rerio] Length = 3842 Score = 54.3 bits (129), Expect = 8e-06 Identities = 31/73 (42%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = -3 Query: 259 PIPKPLPSLHSSTQDSPQISDSLQAQ*NLDPNPIHLPSLHQTAPDPSPASHPH-QPKHLL 83 P P P+P S Q +PQI +Q Q + P P P HQ P P P HPH QP+ Sbjct: 254 PKPDPIPKTQPSAQPTPQIQPQMQTQMKIQPQPHPQPQPHQ-QPQPHPQPHPHPQPQPHP 312 Query: 82 DPSPQA-SGLQPQ 47 P P A SG+Q Q Sbjct: 313 QPQPHAVSGIQRQ 325 >ref|XP_001920788.3| protein bassoon isoform X1 [Danio rerio] Length = 4097 Score = 54.3 bits (129), Expect = 8e-06 Identities = 31/73 (42%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = -3 Query: 259 PIPKPLPSLHSSTQDSPQISDSLQAQ*NLDPNPIHLPSLHQTAPDPSPASHPH-QPKHLL 83 P P P+P S Q +PQI +Q Q + P P P HQ P P P HPH QP+ Sbjct: 254 PKPDPIPKTQPSAQPTPQIQPQMQTQMKIQPQPHPQPQPHQ-QPQPHPQPHPHPQPQPHP 312 Query: 82 DPSPQA-SGLQPQ 47 P P A SG+Q Q Sbjct: 313 QPQPHAVSGIQRQ 325