BLASTX nr result
ID: Ophiopogon24_contig00009650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00009650 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK67226.1| uncharacterized protein A4U43_C06F17950 [Asparagu... 65 1e-10 >gb|ONK67226.1| uncharacterized protein A4U43_C06F17950 [Asparagus officinalis] Length = 165 Score = 65.1 bits (157), Expect = 1e-10 Identities = 32/59 (54%), Positives = 40/59 (67%), Gaps = 4/59 (6%) Frame = +1 Query: 85 MASISINATHFCSLTSQFQSNPRN----PSTKVSPISPLSPKPTLFTSTPHLHLKQLNK 249 MASIS+N T+ CSL +QFQ P+ + ++P+SP SPKPTL S PHL KQLNK Sbjct: 1 MASISMNGTYLCSLAAQFQRKPQKFLSRSNHNLTPVSPFSPKPTLSLSNPHLPFKQLNK 59