BLASTX nr result
ID: Ophiopogon24_contig00009621
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00009621 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020084819.1| uncharacterized protein LOC109707725 [Ananas... 71 1e-13 gb|PHU12343.1| hypothetical protein BC332_19273 [Capsicum chinense] 67 4e-12 gb|OTG22422.1| hypothetical protein HannXRQ_Chr06g0171351 [Helia... 65 3e-11 ref|XP_007132667.1| hypothetical protein PHAVU_011G114500g, part... 65 3e-11 gb|KOM50243.1| hypothetical protein LR48_Vigan08g107000 [Vigna a... 65 5e-11 emb|CBI21837.3| unnamed protein product, partial [Vitis vinifera] 69 1e-10 gb|OMP07382.1| hypothetical protein COLO4_07391 [Corchorus olito... 63 2e-10 gb|PLY83841.1| hypothetical protein LSAT_3X38100 [Lactuca sativa] 63 3e-10 gb|ONI17062.1| hypothetical protein PRUPE_3G135800 [Prunus persica] 66 8e-10 gb|OAY35281.1| hypothetical protein MANES_12G087300 [Manihot esc... 61 1e-09 gb|KVH95919.1| hypothetical protein Ccrd_001987 [Cynara carduncu... 62 2e-09 gb|ABK94484.1| unknown [Populus trichocarpa] >gi|118488375|gb|AB... 60 2e-09 gb|KZM99636.1| hypothetical protein DCAR_013002 [Daucus carota s... 60 3e-09 gb|KYP46901.1| hypothetical protein KK1_031472 [Cajanus cajan] 65 3e-09 gb|PIN12420.1| hypothetical protein CDL12_14971 [Handroanthus im... 60 3e-09 emb|CDP19552.1| unnamed protein product [Coffea canephora] 60 3e-09 gb|KHN35259.1| hypothetical protein glysoja_042329 [Glycine soja] 63 8e-09 ref|XP_002319899.2| hypothetical protein POPTR_0013s13680g [Popu... 57 4e-08 gb|PNT08200.1| hypothetical protein POPTR_013G133300v3 [Populus ... 57 5e-08 gb|PIA45530.1| hypothetical protein AQUCO_01600013v1 [Aquilegia ... 56 6e-08 >ref|XP_020084819.1| uncharacterized protein LOC109707725 [Ananas comosus] Length = 42 Score = 70.9 bits (172), Expect = 1e-13 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIRG 275 M FE+QLKER+KEL +L+KKG+KVVG+SCKK WHKVKKIRG Sbjct: 1 MGGFEEQLKERAKELKHLVKKGVKVVGESCKKTWHKVKKIRG 42 >gb|PHU12343.1| hypothetical protein BC332_19273 [Capsicum chinense] Length = 42 Score = 67.0 bits (162), Expect = 4e-12 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 M FEKQ+KER+KEL +L KKG+K+VG+SCKKGWHKV+ +R Sbjct: 1 MGGFEKQVKERAKELKSLFKKGVKIVGESCKKGWHKVRHLR 41 >gb|OTG22422.1| hypothetical protein HannXRQ_Chr06g0171351 [Helianthus annuus] Length = 53 Score = 65.1 bits (157), Expect = 3e-11 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 M FE Q+K R++EL N+ KKG K+VGDSCKKGWHKVK IR Sbjct: 12 MGSFENQVKVRAEELKNIFKKGAKIVGDSCKKGWHKVKHIR 52 >ref|XP_007132667.1| hypothetical protein PHAVU_011G114500g, partial [Phaseolus vulgaris] gb|ESW04661.1| hypothetical protein PHAVU_011G114500g, partial [Phaseolus vulgaris] Length = 70 Score = 65.5 bits (158), Expect = 3e-11 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 MA FE+Q+K+R+KEL LLKKG+K+VGDSCKKGW+KVK I+ Sbjct: 29 MAGFEQQVKDRAKELKVLLKKGVKIVGDSCKKGWNKVKHIK 69 >gb|KOM50243.1| hypothetical protein LR48_Vigan08g107000 [Vigna angularis] dbj|BAT90150.1| hypothetical protein VIGAN_06133600 [Vigna angularis var. angularis] Length = 85 Score = 65.5 bits (158), Expect = 5e-11 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 MA FE+Q+K+R+KEL LLKKG+K+VGDSCKKGW+KVK I+ Sbjct: 44 MAGFEQQVKDRAKELKVLLKKGVKIVGDSCKKGWNKVKHIK 84 >emb|CBI21837.3| unnamed protein product, partial [Vitis vinifera] Length = 388 Score = 68.9 bits (167), Expect = 1e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIRG 275 MA+FEKQLKER++EL KKG+K+VGDSCKKGW+KV+ +RG Sbjct: 330 MAEFEKQLKERARELKTFFKKGVKIVGDSCKKGWYKVRHMRG 371 >gb|OMP07382.1| hypothetical protein COLO4_07391 [Corchorus olitorius] Length = 42 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 MA FE+Q+KER+KEL KK +K+VGDSCKKGW+KVK IR Sbjct: 1 MAGFEQQVKERAKELKVFFKKSVKIVGDSCKKGWYKVKHIR 41 >gb|PLY83841.1| hypothetical protein LSAT_3X38100 [Lactuca sativa] Length = 61 Score = 62.8 bits (151), Expect = 3e-10 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 M FE Q+KER++EL KG K+VGDSCKKGWHKVK IR Sbjct: 1 MGSFENQVKERAEELKKFFSKGAKIVGDSCKKGWHKVKHIR 41 >gb|ONI17062.1| hypothetical protein PRUPE_3G135800 [Prunus persica] Length = 287 Score = 66.2 bits (160), Expect = 8e-10 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 MA FE ++KER++ELT L+KKG+KVVGDSCKKGW+KVK IR Sbjct: 246 MAGFEHKVKERARELTILVKKGVKVVGDSCKKGWYKVKHIR 286 >gb|OAY35281.1| hypothetical protein MANES_12G087300 [Manihot esculenta] Length = 42 Score = 60.8 bits (146), Expect = 1e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 MA FE+Q+KER+KEL KKG+K+VG+SCKKGW+KVK ++ Sbjct: 1 MAGFEQQVKERAKELKIFFKKGVKIVGESCKKGWNKVKHMK 41 >gb|KVH95919.1| hypothetical protein Ccrd_001987 [Cynara cardunculus var. scolymus] Length = 104 Score = 62.0 bits (149), Expect = 2e-09 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 M FE Q+K+R++EL + K+G K+VGDSCKKGWHKVK +R Sbjct: 63 MGSFENQVKDRAEELKRIFKQGAKIVGDSCKKGWHKVKHLR 103 >gb|ABK94484.1| unknown [Populus trichocarpa] gb|ABK96005.1| unknown [Populus trichocarpa] Length = 43 Score = 60.1 bits (144), Expect = 2e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 M DFE ++K R+KELT L KKG+K+VG+SCKKGW KVK ++ Sbjct: 1 MGDFENKVKVRAKELTVLFKKGVKIVGESCKKGWIKVKNMK 41 >gb|KZM99636.1| hypothetical protein DCAR_013002 [Daucus carota subsp. sativus] Length = 68 Score = 60.5 bits (145), Expect = 3e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 M FEKQ+KER+KE+ + L KG KVVG+SCKKGW K+K IR Sbjct: 26 MGGFEKQVKERAKEMKHYLNKGAKVVGESCKKGWLKLKNIR 66 >gb|KYP46901.1| hypothetical protein KK1_031472 [Cajanus cajan] Length = 357 Score = 65.1 bits (157), Expect = 3e-09 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = -3 Query: 403 TMADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 +MA FE+Q+K+R++EL LLKKG+K+VGDSCKKGW+KVK I+ Sbjct: 315 SMAGFEQQMKDRARELKVLLKKGVKIVGDSCKKGWNKVKHIK 356 >gb|PIN12420.1| hypothetical protein CDL12_14971 [Handroanthus impetiginosus] Length = 42 Score = 59.7 bits (143), Expect = 3e-09 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 M +FE+Q+KER+K L K+G K+VGDSCKKGW+KVK +R Sbjct: 1 MVNFERQVKERAKGLKVFFKRGFKIVGDSCKKGWYKVKHLR 41 >emb|CDP19552.1| unnamed protein product [Coffea canephora] Length = 42 Score = 59.7 bits (143), Expect = 3e-09 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 M FE ++KER+KEL + ++G+K+VGDSCKKGW+KVK IR Sbjct: 1 MGSFEHKVKERAKELKIIFQRGVKIVGDSCKKGWYKVKHIR 41 >gb|KHN35259.1| hypothetical protein glysoja_042329 [Glycine soja] Length = 232 Score = 62.8 bits (151), Expect = 8e-09 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIR 278 M FE+++K+R+KEL LLKKG+K+VGDSCKKGW+KVK I+ Sbjct: 191 MGGFEQKMKDRAKELKVLLKKGVKIVGDSCKKGWNKVKHIK 231 >ref|XP_002319899.2| hypothetical protein POPTR_0013s13680g [Populus trichocarpa] Length = 50 Score = 57.0 bits (136), Expect = 4e-08 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKI 281 M DFEKQ+KER+KEL L KG+K+V +SCKKGW K+ ++ Sbjct: 1 MGDFEKQVKERAKELKVLFTKGVKIVENSCKKGWKKISQV 40 >gb|PNT08200.1| hypothetical protein POPTR_013G133300v3 [Populus trichocarpa] Length = 59 Score = 57.0 bits (136), Expect = 5e-08 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKI 281 M DFEKQ+KER+KEL L KG+K+V +SCKKGW K+ ++ Sbjct: 1 MGDFEKQVKERAKELKVLFTKGVKIVENSCKKGWKKISQV 40 >gb|PIA45530.1| hypothetical protein AQUCO_01600013v1 [Aquilegia coerulea] Length = 42 Score = 56.2 bits (134), Expect = 6e-08 Identities = 23/42 (54%), Positives = 34/42 (80%) Frame = -3 Query: 400 MADFEKQLKERSKELTNLLKKGMKVVGDSCKKGWHKVKKIRG 275 MA+F+ Q+KE++K+L KK +K+V +SCKKGW+KVK I+G Sbjct: 1 MANFQLQVKEKTKDLKVFFKKSVKIVSESCKKGWYKVKHIKG 42