BLASTX nr result
ID: Ophiopogon24_contig00009426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00009426 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB43863.1| gamma-ECS, partial [Mesembryanthemum crystallinum] 70 7e-13 ref|XP_008392576.1| PREDICTED: glutamate--cysteine ligase, chlor... 71 1e-12 ref|XP_009350437.1| PREDICTED: glutamate--cysteine ligase, chlor... 73 2e-12 ref|XP_017179198.1| PREDICTED: glutamate--cysteine ligase, chlor... 73 2e-12 ref|XP_011080960.1| glutamate--cysteine ligase, chloroplastic-li... 72 3e-12 ref|XP_020276554.1| glutamate--cysteine ligase, chloroplastic [A... 71 6e-12 ref|XP_019171174.1| PREDICTED: glutamate--cysteine ligase, chlor... 71 6e-12 ref|XP_019171173.1| PREDICTED: glutamate--cysteine ligase, chlor... 71 6e-12 gb|ONK62683.1| uncharacterized protein A4U43_C07F6880 [Asparagus... 71 6e-12 gb|KDO76210.1| hypothetical protein CISIN_1g010751mg [Citrus sin... 70 9e-12 gb|KDO76213.1| hypothetical protein CISIN_1g010751mg [Citrus sin... 70 9e-12 gb|PNT45254.1| hypothetical protein POPTR_003G126900v3 [Populus ... 70 1e-11 gb|KDO76211.1| hypothetical protein CISIN_1g010751mg [Citrus sin... 70 1e-11 gb|ESR52795.1| hypothetical protein CICLE_v10019696mg [Citrus cl... 70 1e-11 gb|ESR52796.1| hypothetical protein CICLE_v10019696mg [Citrus cl... 70 1e-11 gb|KDO76206.1| hypothetical protein CISIN_1g010751mg [Citrus sin... 70 1e-11 gb|PAN17062.1| hypothetical protein PAHAL_C01199 [Panicum hallii] 70 1e-11 ref|XP_004960382.1| glutamate--cysteine ligase A, chloroplastic ... 70 1e-11 ref|XP_002439220.1| glutamate--cysteine ligase A, chloroplastic ... 70 1e-11 gb|KDO76209.1| hypothetical protein CISIN_1g010751mg [Citrus sin... 70 1e-11 >emb|CAB43863.1| gamma-ECS, partial [Mesembryanthemum crystallinum] Length = 136 Score = 70.1 bits (170), Expect = 7e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYR KRYVDCAG+SFRD + Sbjct: 83 FEQYVDYALDVPMYFVYRQKRYVDCAGLSFRDFM 116 >ref|XP_008392576.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Malus domestica] Length = 218 Score = 71.2 bits (173), Expect = 1e-12 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -2 Query: 272 VLIFHRFEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 + + RFEQYVDYALDVPMYFVYR K+Y+DC GMSFRD L Sbjct: 15 IYLLCRFEQYVDYALDVPMYFVYRQKKYIDCTGMSFRDFL 54 >ref|XP_009350437.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform X2 [Pyrus x bretschneideri] Length = 503 Score = 72.8 bits (177), Expect = 2e-12 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 269 LIFHRFEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 L RFEQYVDYALDVPMYFVYRNK+Y+DC GM+FRD L Sbjct: 301 LSMRRFEQYVDYALDVPMYFVYRNKKYIDCTGMTFRDFL 339 >ref|XP_017179198.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform X3 [Malus domestica] Length = 527 Score = 72.8 bits (177), Expect = 2e-12 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -2 Query: 269 LIFHRFEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 L RFEQYVDYALDVPMYFVYRNK+Y+DC GM+FRD L Sbjct: 301 LSMRRFEQYVDYALDVPMYFVYRNKKYIDCTGMTFRDFL 339 >ref|XP_011080960.1| glutamate--cysteine ligase, chloroplastic-like [Sesamum indicum] Length = 526 Score = 72.0 bits (175), Expect = 3e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYRNK+Y+DCAGMSFRD + Sbjct: 329 FEQYVDYALDVPMYFVYRNKKYIDCAGMSFRDFM 362 >ref|XP_020276554.1| glutamate--cysteine ligase, chloroplastic [Asparagus officinalis] Length = 503 Score = 71.2 bits (173), Expect = 6e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYRNKRY+DC G+SFRD L Sbjct: 306 FEQYVDYALDVPMYFVYRNKRYIDCTGLSFRDFL 339 >ref|XP_019171174.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform X2 [Ipomoea nil] Length = 507 Score = 71.2 bits (173), Expect = 6e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYRN RY+DCAGMSFRD + Sbjct: 310 FEQYVDYALDVPMYFVYRNNRYIDCAGMSFRDFM 343 >ref|XP_019171173.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform X1 [Ipomoea nil] Length = 518 Score = 71.2 bits (173), Expect = 6e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYRN RY+DCAGMSFRD + Sbjct: 321 FEQYVDYALDVPMYFVYRNNRYIDCAGMSFRDFM 354 >gb|ONK62683.1| uncharacterized protein A4U43_C07F6880 [Asparagus officinalis] Length = 599 Score = 71.2 bits (173), Expect = 6e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYRNKRY+DC G+SFRD L Sbjct: 387 FEQYVDYALDVPMYFVYRNKRYIDCTGLSFRDFL 420 >gb|KDO76210.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis] Length = 396 Score = 70.5 bits (171), Expect = 9e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYR K+Y+DCAGMSFRD L Sbjct: 199 FEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFL 232 >gb|KDO76213.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis] Length = 397 Score = 70.5 bits (171), Expect = 9e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYR K+Y+DCAGMSFRD L Sbjct: 291 FEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFL 324 >gb|PNT45254.1| hypothetical protein POPTR_003G126900v3 [Populus trichocarpa] Length = 411 Score = 70.5 bits (171), Expect = 1e-11 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLLHRQG 141 FEQYVDYALDVPMYFVYR ++Y+DC GMSFRD L R+G Sbjct: 329 FEQYVDYALDVPMYFVYRKEKYIDCTGMSFRDGLERRG 366 >gb|KDO76211.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis] gb|KDO76212.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis] Length = 427 Score = 70.5 bits (171), Expect = 1e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYR K+Y+DCAGMSFRD L Sbjct: 291 FEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFL 324 >gb|ESR52795.1| hypothetical protein CICLE_v10019696mg [Citrus clementina] Length = 465 Score = 70.5 bits (171), Expect = 1e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYR K+Y+DCAGMSFRD L Sbjct: 329 FEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFL 362 >gb|ESR52796.1| hypothetical protein CICLE_v10019696mg [Citrus clementina] Length = 487 Score = 70.5 bits (171), Expect = 1e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYR K+Y+DCAGMSFRD L Sbjct: 329 FEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFL 362 >gb|KDO76206.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis] gb|KDO76207.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis] gb|KDO76208.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis] Length = 488 Score = 70.5 bits (171), Expect = 1e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYR K+Y+DCAGMSFRD L Sbjct: 291 FEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFL 324 >gb|PAN17062.1| hypothetical protein PAHAL_C01199 [Panicum hallii] Length = 496 Score = 70.5 bits (171), Expect = 1e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYRNK+Y+DC GMSFRD + Sbjct: 299 FEQYVDYALDVPMYFVYRNKKYIDCTGMSFRDFM 332 >ref|XP_004960382.1| glutamate--cysteine ligase A, chloroplastic [Setaria italica] gb|KQL13197.1| hypothetical protein SETIT_021842mg [Setaria italica] Length = 498 Score = 70.5 bits (171), Expect = 1e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYRNK+Y+DC GMSFRD + Sbjct: 301 FEQYVDYALDVPMYFVYRNKKYIDCTGMSFRDFM 334 >ref|XP_002439220.1| glutamate--cysteine ligase A, chloroplastic [Sorghum bicolor] gb|EES17650.1| hypothetical protein SORBI_3009G029600 [Sorghum bicolor] Length = 501 Score = 70.5 bits (171), Expect = 1e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYRNK+Y+DC GMSFRD + Sbjct: 304 FEQYVDYALDVPMYFVYRNKKYIDCTGMSFRDFM 337 >gb|KDO76209.1| hypothetical protein CISIN_1g010751mg [Citrus sinensis] Length = 502 Score = 70.5 bits (171), Expect = 1e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 254 FEQYVDYALDVPMYFVYRNKRYVDCAGMSFRDLL 153 FEQYVDYALDVPMYFVYR K+Y+DCAGMSFRD L Sbjct: 305 FEQYVDYALDVPMYFVYRKKKYIDCAGMSFRDFL 338