BLASTX nr result
ID: Ophiopogon24_contig00009327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00009327 (792 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020257348.1| pentatricopeptide repeat-containing protein ... 111 3e-24 ref|XP_010939594.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-18 ref|XP_009401449.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-18 ref|XP_008804499.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-18 ref|XP_020091071.1| pentatricopeptide repeat-containing protein ... 93 1e-17 gb|OAY79290.1| Pentatricopeptide repeat-containing protein, chlo... 91 6e-17 ref|XP_020701243.1| pentatricopeptide repeat-containing protein ... 90 8e-17 gb|PKU74097.1| Pentatricopeptide repeat-containing protein [Dend... 90 1e-16 gb|OIT18668.1| pentatricopeptide repeat-containing protein, chlo... 85 1e-16 ref|XP_020589669.1| pentatricopeptide repeat-containing protein ... 89 2e-16 gb|PKA64369.1| Pentatricopeptide repeat-containing protein [Apos... 89 2e-16 emb|CDP01388.1| unnamed protein product [Coffea canephora] 87 8e-16 ref|XP_016441969.1| PREDICTED: pentatricopeptide repeat-containi... 86 2e-15 ref|XP_009608341.1| PREDICTED: pentatricopeptide repeat-containi... 86 2e-15 ref|XP_010245873.1| PREDICTED: pentatricopeptide repeat-containi... 85 6e-15 ref|XP_015890905.1| PREDICTED: pentatricopeptide repeat-containi... 79 6e-15 ref|XP_019224228.1| PREDICTED: pentatricopeptide repeat-containi... 84 8e-15 ref|XP_016444053.1| PREDICTED: pentatricopeptide repeat-containi... 84 8e-15 ref|XP_009762907.1| PREDICTED: pentatricopeptide repeat-containi... 84 8e-15 ref|XP_008440667.1| PREDICTED: pentatricopeptide repeat-containi... 84 9e-15 >ref|XP_020257348.1| pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Asparagus officinalis] gb|ONK75482.1| uncharacterized protein A4U43_C03F17320 [Asparagus officinalis] Length = 493 Score = 111 bits (277), Expect = 3e-24 Identities = 55/82 (67%), Positives = 61/82 (74%) Frame = +1 Query: 112 KRPVRIATFXXXXXXXXXXXXXSLRGISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVR 291 K P +I TF L GISEP+ELVR ILKKS +EK+PLV+TLGKYV V+R Sbjct: 42 KDPSKIVTFCCRRLPRRRAAPPRLGGISEPEELVRTILKKSSEEKKPLVATLGKYVRVLR 101 Query: 292 TEHCFLLFEELGKRDNWLQCLE 357 TEHCFLLFEELGKRDNWLQCLE Sbjct: 102 TEHCFLLFEELGKRDNWLQCLE 123 >ref|XP_010939594.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Elaeis guineensis] Length = 487 Score = 95.1 bits (235), Expect = 2e-18 Identities = 43/57 (75%), Positives = 52/57 (91%) Frame = +1 Query: 187 GISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 G E +ELVR+IL+K+GD K+PLV+TL KYV+VVRTEHCF+LFEELGKRD+WLQCLE Sbjct: 61 GQPEAEELVRVILRKAGDGKEPLVATLSKYVKVVRTEHCFMLFEELGKRDSWLQCLE 117 >ref|XP_009401449.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Musa acuminata subsp. malaccensis] Length = 498 Score = 95.1 bits (235), Expect = 2e-18 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = +1 Query: 184 RGISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 R SE ELVR++L+KSGD K+PLV TL K+V VVRTEHCFLLFEELGKRDNWLQCLE Sbjct: 73 RDDSEAAELVRVVLRKSGDGKEPLVVTLSKFVRVVRTEHCFLLFEELGKRDNWLQCLE 130 >ref|XP_008804499.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Phoenix dactylifera] Length = 485 Score = 94.7 bits (234), Expect = 2e-18 Identities = 43/57 (75%), Positives = 52/57 (91%) Frame = +1 Query: 187 GISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 G E +ELVR+IL+K+G K+PLV+TLGKYV+VVRTEHCF+LFEELGKRD+WLQCLE Sbjct: 61 GQPEEEELVRVILRKAGGGKEPLVATLGKYVKVVRTEHCFMLFEELGKRDSWLQCLE 117 >ref|XP_020091071.1| pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Ananas comosus] Length = 500 Score = 92.8 bits (229), Expect = 1e-17 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = +1 Query: 187 GISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 G SE +ELVR++L++SG K+PLV+TL KYV VVRTEHCFLLFEELGKRD WLQCLE Sbjct: 69 GSSEVEELVRLLLRRSGVGKEPLVATLDKYVRVVRTEHCFLLFEELGKRDGWLQCLE 125 >gb|OAY79290.1| Pentatricopeptide repeat-containing protein, chloroplastic [Ananas comosus] Length = 500 Score = 90.5 bits (223), Expect = 6e-17 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = +1 Query: 187 GISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 G SE +ELVR++L++SG K+PLV+ L KYV VVRTEHCFLLFEELGKRD WLQCLE Sbjct: 69 GSSEVEELVRLLLRRSGVGKEPLVAMLDKYVRVVRTEHCFLLFEELGKRDGWLQCLE 125 >ref|XP_020701243.1| pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Dendrobium catenatum] Length = 487 Score = 90.1 bits (222), Expect = 8e-17 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = +1 Query: 196 EPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 E DELVR++L+K GDEK PLV+TL KYV VRTEHCFLLFEELG++D WLQCLE Sbjct: 81 EVDELVRVLLRKVGDEKFPLVTTLNKYVRTVRTEHCFLLFEELGRQDKWLQCLE 134 >gb|PKU74097.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 550 Score = 90.1 bits (222), Expect = 1e-16 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = +1 Query: 196 EPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 E DELVR++L+K GDEK PLV+TL KYV VRTEHCFLLFEELG++D WLQCLE Sbjct: 144 EVDELVRVLLRKVGDEKFPLVTTLNKYVRTVRTEHCFLLFEELGRQDKWLQCLE 197 >gb|OIT18668.1| pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 171 Score = 85.1 bits (209), Expect = 1e-16 Identities = 42/61 (68%), Positives = 47/61 (77%) Frame = +1 Query: 187 GISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLERAS 366 G SE ELV +++K D+K PLVSTL KYV+ VRTEHCFLLFEELGK DNWLQCLE Sbjct: 64 GSSEAQELVTLLMKNFSDKK-PLVSTLNKYVKFVRTEHCFLLFEELGKTDNWLQCLEELV 122 Query: 367 Q 369 Q Sbjct: 123 Q 123 >ref|XP_020589669.1| pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Phalaenopsis equestris] Length = 487 Score = 89.4 bits (220), Expect = 2e-16 Identities = 39/55 (70%), Positives = 49/55 (89%) Frame = +1 Query: 193 SEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 +E +EL+R++L+K+GDEK PLV+TL KYV VRTEHCFLLFEELG++D WLQCLE Sbjct: 80 TESEELMRVLLRKAGDEKFPLVTTLNKYVRTVRTEHCFLLFEELGRQDKWLQCLE 134 >gb|PKA64369.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 476 Score = 89.0 bits (219), Expect = 2e-16 Identities = 42/59 (71%), Positives = 50/59 (84%), Gaps = 1/59 (1%) Frame = +1 Query: 184 RGI-SEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 RG+ SE +++VR++L+K+ D K PLVSTL KYV VRTEHCFLLFEELGKRD WLQCLE Sbjct: 62 RGVASEAEDVVRILLRKASDLKYPLVSTLNKYVTTVRTEHCFLLFEELGKRDKWLQCLE 120 >emb|CDP01388.1| unnamed protein product [Coffea canephora] Length = 598 Score = 87.4 bits (215), Expect = 8e-16 Identities = 39/58 (67%), Positives = 49/58 (84%) Frame = +1 Query: 184 RGISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 R ISE +ELV ++++ ++KQPLV+TL KYV++VRTEHCFLLFEELGK D WLQCLE Sbjct: 134 RAISEAEELVGLLMRNFDEKKQPLVATLNKYVKLVRTEHCFLLFEELGKTDKWLQCLE 191 >ref|XP_016441969.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Nicotiana tabacum] Length = 488 Score = 86.3 bits (212), Expect = 2e-15 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = +1 Query: 178 SLRGISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 S RG SE ELV ++++ D+K PLVSTL KYV+ VRTEHCFLLFEELGK DNWLQCLE Sbjct: 61 STRGSSEAQELVTLLMRNFSDKK-PLVSTLNKYVKFVRTEHCFLLFEELGKTDNWLQCLE 119 >ref|XP_009608341.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Nicotiana tomentosiformis] Length = 488 Score = 86.3 bits (212), Expect = 2e-15 Identities = 42/60 (70%), Positives = 48/60 (80%) Frame = +1 Query: 178 SLRGISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 S RG SE ELV ++++ D+K PLVSTL KYV+ VRTEHCFLLFEELGK DNWLQCLE Sbjct: 61 STRGSSEEQELVTLLMRNFSDKK-PLVSTLNKYVKFVRTEHCFLLFEELGKTDNWLQCLE 119 >ref|XP_010245873.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Nelumbo nucifera] Length = 491 Score = 84.7 bits (208), Expect = 6e-15 Identities = 41/55 (74%), Positives = 46/55 (83%) Frame = +1 Query: 193 SEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 SE ELVR +L+ D+K PLVSTL KYV++VRTEHCFLLFEELGKRD WLQCLE Sbjct: 67 SEAGELVRFLLRNFSDQK-PLVSTLNKYVKLVRTEHCFLLFEELGKRDRWLQCLE 120 >ref|XP_015890905.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Ziziphus jujuba] Length = 128 Score = 79.3 bits (194), Expect = 6e-15 Identities = 36/59 (61%), Positives = 47/59 (79%) Frame = +1 Query: 193 SEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLERASQ 369 SE +ELVR++++ D K+PL+ TL KYV++VRTEHCF LFEELGK D WLQCLE ++ Sbjct: 63 SEAEELVRLLMRSFSD-KEPLLKTLNKYVKIVRTEHCFHLFEELGKSDKWLQCLEENAE 120 >ref|XP_019224228.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Nicotiana attenuata] gb|OIT33517.1| pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 488 Score = 84.3 bits (207), Expect = 8e-15 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = +1 Query: 187 GISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 G SE ELV +++K D+K PLVSTL KYV+ VRTEHCFLLFEELGK DNWLQCLE Sbjct: 64 GSSEAQELVTLLMKNFSDKK-PLVSTLNKYVKFVRTEHCFLLFEELGKTDNWLQCLE 119 >ref|XP_016444053.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Nicotiana tabacum] Length = 488 Score = 84.3 bits (207), Expect = 8e-15 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = +1 Query: 187 GISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 G SE ELV +++K D+K PLVSTL KYV+ VRTEHCFLLFEELGK DNWLQCLE Sbjct: 64 GSSEAQELVTLLMKNFSDKK-PLVSTLNKYVKFVRTEHCFLLFEELGKTDNWLQCLE 119 >ref|XP_009762907.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Nicotiana sylvestris] Length = 488 Score = 84.3 bits (207), Expect = 8e-15 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = +1 Query: 187 GISEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 G SE ELV +++K D+K PLVSTL KYV+ VRTEHCFLLFEELGK DNWLQCLE Sbjct: 64 GSSEAQELVTLLMKNFSDKK-PLVSTLNKYVKFVRTEHCFLLFEELGKTDNWLQCLE 119 >ref|XP_008440667.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Cucumis melo] Length = 531 Score = 84.3 bits (207), Expect = 9e-15 Identities = 41/55 (74%), Positives = 46/55 (83%) Frame = +1 Query: 193 SEPDELVRMILKKSGDEKQPLVSTLGKYVEVVRTEHCFLLFEELGKRDNWLQCLE 357 SE +ELVR I+KK D K+PL+ TL KYV V+RTEHCFLLFEELGKRD WLQCLE Sbjct: 62 SEAEELVRGIIKKFSD-KEPLLKTLDKYVRVMRTEHCFLLFEELGKRDKWLQCLE 115