BLASTX nr result
ID: Ophiopogon24_contig00008911
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00008911 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008785767.1| PREDICTED: uncharacterized protein LOC103704... 62 3e-09 ref|XP_020273792.1| conserved oligomeric Golgi complex subunit 3... 64 7e-09 ref|XP_020256737.1| conserved oligomeric Golgi complex subunit 3... 64 9e-09 gb|OAY72837.1| Conserved oligomeric Golgi complex subunit 3 [Ana... 64 1e-08 ref|XP_020090509.1| conserved oligomeric Golgi complex subunit 3... 61 1e-07 gb|OAY85675.1| Conserved oligomeric Golgi complex subunit 3 [Ana... 61 1e-07 gb|PAN35633.1| hypothetical protein PAHAL_F01832 [Panicum hallii] 60 1e-07 gb|PAN35632.1| hypothetical protein PAHAL_F01832 [Panicum hallii] 60 1e-07 ref|XP_004973591.1| conserved oligomeric Golgi complex subunit 3... 60 2e-07 ref|XP_022888767.1| conserved oligomeric Golgi complex subunit 3... 60 2e-07 gb|OEL19623.1| Conserved oligomeric Golgi complex subunit 3 [Dic... 60 2e-07 ref|XP_022888766.1| conserved oligomeric Golgi complex subunit 3... 60 2e-07 gb|EOA34883.1| hypothetical protein CARUB_v10022466mg [Capsella ... 59 4e-07 ref|XP_023644128.1| conserved oligomeric Golgi complex subunit 3... 59 4e-07 ref|XP_006304515.1| conserved oligomeric Golgi complex subunit 3... 59 4e-07 ref|XP_023644127.1| conserved oligomeric Golgi complex subunit 3... 59 4e-07 ref|XP_010939335.1| PREDICTED: conserved oligomeric Golgi comple... 59 5e-07 ref|XP_021804976.1| conserved oligomeric Golgi complex subunit 3... 59 5e-07 ref|XP_016651945.1| PREDICTED: conserved oligomeric Golgi comple... 59 5e-07 ref|XP_007204277.1| conserved oligomeric Golgi complex subunit 3... 59 5e-07 >ref|XP_008785767.1| PREDICTED: uncharacterized protein LOC103704313 [Phoenix dactylifera] Length = 112 Score = 61.6 bits (148), Expect = 3e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 104 MATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 MATASLPKS AVS+GYNF S WEQNAPLTEQQ A Sbjct: 1 MATASLPKSEAVSKGYNFASTWEQNAPLTEQQKA 34 >ref|XP_020273792.1| conserved oligomeric Golgi complex subunit 3-like [Asparagus officinalis] gb|ONK65534.1| uncharacterized protein A4U43_C07F38090 [Asparagus officinalis] Length = 778 Score = 64.3 bits (155), Expect = 7e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 MATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 MATA+LPKSGA+SRGYNF S W+QNAPLT++QHA Sbjct: 1 MATANLPKSGAISRGYNFASTWDQNAPLTDEQHA 34 >ref|XP_020256737.1| conserved oligomeric Golgi complex subunit 3-like [Asparagus officinalis] gb|ONK74925.1| uncharacterized protein A4U43_C03F11520 [Asparagus officinalis] Length = 775 Score = 63.9 bits (154), Expect = 9e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 104 MATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 MATAS PKSGA+SRGYNF S WEQ+APLTE+QHA Sbjct: 1 MATASFPKSGAISRGYNFASTWEQHAPLTEKQHA 34 >gb|OAY72837.1| Conserved oligomeric Golgi complex subunit 3 [Ananas comosus] Length = 875 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 119 LLSSPMATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 L SSPM T +LPKSGAVS+GY+F S WEQNAPLT+QQ A Sbjct: 93 LSSSPMVTTTLPKSGAVSKGYSFASTWEQNAPLTDQQKA 131 >ref|XP_020090509.1| conserved oligomeric Golgi complex subunit 3-like isoform X1 [Ananas comosus] Length = 777 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 104 MATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 MAT +LPKSGAVS+GYNF S WEQNAPLT+QQ A Sbjct: 1 MATTTLPKSGAVSKGYNFASTWEQNAPLTDQQKA 34 >gb|OAY85675.1| Conserved oligomeric Golgi complex subunit 3 [Ananas comosus] Length = 777 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 104 MATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 MAT +LPKSGAVS+GYNF S WEQNAPLT+QQ A Sbjct: 1 MATTTLPKSGAVSKGYNFASTWEQNAPLTDQQKA 34 >gb|PAN35633.1| hypothetical protein PAHAL_F01832 [Panicum hallii] Length = 741 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 119 LLSSPMATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 + ++P ++LPKSGAVS+GYNF S WEQNAPLTEQQ A Sbjct: 1 MATTPATASALPKSGAVSKGYNFASTWEQNAPLTEQQKA 39 >gb|PAN35632.1| hypothetical protein PAHAL_F01832 [Panicum hallii] Length = 780 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 119 LLSSPMATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 + ++P ++LPKSGAVS+GYNF S WEQNAPLTEQQ A Sbjct: 1 MATTPATASALPKSGAVSKGYNFASTWEQNAPLTEQQKA 39 >ref|XP_004973591.1| conserved oligomeric Golgi complex subunit 3 [Setaria italica] gb|KQL02031.1| hypothetical protein SETIT_013288mg [Setaria italica] Length = 780 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 119 LLSSPMATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 + ++P ++LPKSGAVS+GYNF S WEQNAPLTEQQ A Sbjct: 1 MATTPAPASALPKSGAVSKGYNFASTWEQNAPLTEQQKA 39 >ref|XP_022888767.1| conserved oligomeric Golgi complex subunit 3 isoform X2 [Olea europaea var. sylvestris] Length = 782 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -1 Query: 116 LSSPMATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 +S+ A +PKSGA+S+GYNF SNWEQNAPLTEQQ A Sbjct: 1 MSATAAKPGVPKSGAISKGYNFASNWEQNAPLTEQQQA 38 >gb|OEL19623.1| Conserved oligomeric Golgi complex subunit 3 [Dichanthelium oligosanthes] Length = 782 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 110 SPMATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 +P ++LPKSGAVSRGYNF S WEQNAPLTEQQ A Sbjct: 6 APGTASALPKSGAVSRGYNFASTWEQNAPLTEQQKA 41 >ref|XP_022888766.1| conserved oligomeric Golgi complex subunit 3 isoform X1 [Olea europaea var. sylvestris] Length = 784 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -1 Query: 116 LSSPMATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 +S+ A +PKSGA+S+GYNF SNWEQNAPLTEQQ A Sbjct: 1 MSATAAKPGVPKSGAISKGYNFASNWEQNAPLTEQQQA 38 >gb|EOA34883.1| hypothetical protein CARUB_v10022466mg [Capsella rubella] Length = 763 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 101 ATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 +++SLPKSGA+S+GYNF SNWEQ+APLTEQQ A Sbjct: 7 SSSSLPKSGAISKGYNFASNWEQSAPLTEQQQA 39 >ref|XP_023644128.1| conserved oligomeric Golgi complex subunit 3 isoform X2 [Capsella rubella] Length = 785 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 101 ATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 +++SLPKSGA+S+GYNF SNWEQ+APLTEQQ A Sbjct: 8 SSSSLPKSGAISKGYNFASNWEQSAPLTEQQQA 40 >ref|XP_006304515.1| conserved oligomeric Golgi complex subunit 3 [Capsella rubella] gb|EOA37413.1| hypothetical protein CARUB_v10011342mg [Capsella rubella] Length = 785 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 101 ATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 +++SLPKSGA+S+GYNF SNWEQ+APLTEQQ A Sbjct: 7 SSSSLPKSGAISKGYNFASNWEQSAPLTEQQQA 39 >ref|XP_023644127.1| conserved oligomeric Golgi complex subunit 3 isoform X1 [Capsella rubella] Length = 791 Score = 59.3 bits (142), Expect = 4e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 101 ATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 +++SLPKSGA+S+GYNF SNWEQ+APLTEQQ A Sbjct: 8 SSSSLPKSGAISKGYNFASNWEQSAPLTEQQQA 40 >ref|XP_010939335.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 [Elaeis guineensis] ref|XP_010939336.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 [Elaeis guineensis] ref|XP_010939337.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 [Elaeis guineensis] ref|XP_010939338.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 [Elaeis guineensis] Length = 777 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 104 MATASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 MAT +LPKS AVS+GYNF S WEQNAPLTEQQ A Sbjct: 1 MATTTLPKSEAVSKGYNFASTWEQNAPLTEQQKA 34 >ref|XP_021804976.1| conserved oligomeric Golgi complex subunit 3 isoform X2 [Prunus avium] Length = 780 Score = 58.9 bits (141), Expect = 5e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 95 ASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 A+LPKSGA+S+GYNF SNWEQN PLTEQQ A Sbjct: 5 ANLPKSGAISKGYNFASNWEQNTPLTEQQQA 35 >ref|XP_016651945.1| PREDICTED: conserved oligomeric Golgi complex subunit 3 isoform X2 [Prunus mume] Length = 780 Score = 58.9 bits (141), Expect = 5e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 95 ASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 A+LPKSGA+S+GYNF SNWEQN PLTEQQ A Sbjct: 5 ANLPKSGAISKGYNFASNWEQNTPLTEQQQA 35 >ref|XP_007204277.1| conserved oligomeric Golgi complex subunit 3 isoform X2 [Prunus persica] Length = 780 Score = 58.9 bits (141), Expect = 5e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 95 ASLPKSGAVSRGYNFTSNWEQNAPLTEQQHA 3 A+LPKSGA+S+GYNF SNWEQN PLTEQQ A Sbjct: 5 ANLPKSGAISKGYNFASNWEQNTPLTEQQQA 35