BLASTX nr result
ID: Ophiopogon24_contig00008486
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00008486 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63299.1| uncharacterized protein A4U43_C07F13530 [Asparagu... 55 3e-06 >gb|ONK63299.1| uncharacterized protein A4U43_C07F13530 [Asparagus officinalis] Length = 199 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = -3 Query: 113 MDPSAADWIAAENKAFKNALAEVDLNSSNWFEHL 12 MDP DW ENKAFK L EVDL++SNWFEHL Sbjct: 1 MDPCTTDWTEPENKAFKEVLVEVDLHASNWFEHL 34