BLASTX nr result
ID: Ophiopogon24_contig00008364
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00008364 (478 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253223.1| uncharacterized protein LOC109830384 [Aspara... 57 3e-06 >ref|XP_020253223.1| uncharacterized protein LOC109830384 [Asparagus officinalis] gb|ONK77544.1| uncharacterized protein A4U43_C02F7680 [Asparagus officinalis] Length = 697 Score = 56.6 bits (135), Expect = 3e-06 Identities = 48/123 (39%), Positives = 63/123 (51%), Gaps = 19/123 (15%) Frame = +1 Query: 82 SPLSVLQLP-SRSNELREETPGSADSS--------------EPADDSGAGARDEEDHGDY 216 SP SVL+ P S N+L E P S SS +P + D E DY Sbjct: 578 SPHSVLEHPTSNENKLTNEIPRSKTSSICPGGEKGIKTDYKKPVELEEGEICDMEGETDY 637 Query: 217 ----ELEEGEIYERYVEIEKGDDPEDSNKDLLQFLPLASEYMGIVSKYGSGDELNLELGL 384 ELEEGEI + +E E ++ +D +K LQ P A E MGIV++ GS EL+L+LGL Sbjct: 638 KEPEELEEGEICD--MEGENSEEFDDDDK-YLQLFPQAGEDMGIVAEVGSLSELSLQLGL 694 Query: 385 SQR 393 + R Sbjct: 695 NSR 697