BLASTX nr result
ID: Ophiopogon24_contig00007731
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00007731 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251324.1| LOW QUALITY PROTEIN: EIN3-binding F-box prot... 74 1e-12 >ref|XP_020251324.1| LOW QUALITY PROTEIN: EIN3-binding F-box protein 1-like [Asparagus officinalis] Length = 624 Score = 73.6 bits (179), Expect = 1e-12 Identities = 35/49 (71%), Positives = 37/49 (75%) Frame = -1 Query: 147 MPALVNFGGDDDIRPRGQACCTPLKRSRYGSPFCRGEKKQRPEDCSLDA 1 MPALVNFGGDDDIRPRG C P KRSRY SPF R +KKQ E SLD+ Sbjct: 1 MPALVNFGGDDDIRPRGPLYCQPRKRSRYSSPFRRPQKKQHQEPSSLDS 49