BLASTX nr result
ID: Ophiopogon24_contig00007488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00007488 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273792.1| conserved oligomeric Golgi complex subunit 3... 57 1e-06 gb|OAY70308.1| Conserved oligomeric Golgi complex subunit 3 [Ana... 55 6e-06 ref|XP_020092151.1| conserved oligomeric Golgi complex subunit 3... 55 9e-06 ref|XP_020092150.1| conserved oligomeric Golgi complex subunit 3... 55 9e-06 ref|XP_020092149.1| conserved oligomeric Golgi complex subunit 3... 55 9e-06 ref|XP_020092147.1| conserved oligomeric Golgi complex subunit 3... 55 9e-06 ref|XP_020092146.1| conserved oligomeric Golgi complex subunit 3... 55 9e-06 ref|XP_020092145.1| conserved oligomeric Golgi complex subunit 3... 55 9e-06 ref|XP_020092143.1| conserved oligomeric Golgi complex subunit 3... 55 9e-06 gb|OAY85675.1| Conserved oligomeric Golgi complex subunit 3 [Ana... 55 9e-06 >ref|XP_020273792.1| conserved oligomeric Golgi complex subunit 3-like [Asparagus officinalis] gb|ONK65534.1| uncharacterized protein A4U43_C07F38090 [Asparagus officinalis] Length = 778 Score = 57.0 bits (136), Expect = 1e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSLIKSDYSAEEM+S+GMVS+QDL AQLD LL Sbjct: 746 LQSLIKSDYSAEEMESMGMVSLQDLQAQLDSLL 778 >gb|OAY70308.1| Conserved oligomeric Golgi complex subunit 3 [Ananas comosus] Length = 271 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSL+KS+YSAEE+Q+IGM+SIQ+L AQLDGLL Sbjct: 239 LQSLLKSEYSAEEIQNIGMLSIQELQAQLDGLL 271 >ref|XP_020092151.1| conserved oligomeric Golgi complex subunit 3-like isoform X7 [Ananas comosus] Length = 678 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSL+KS+YSAEE+Q+IGM+SIQ+L AQLDGLL Sbjct: 646 LQSLLKSEYSAEEIQNIGMLSIQELQAQLDGLL 678 >ref|XP_020092150.1| conserved oligomeric Golgi complex subunit 3-like isoform X6 [Ananas comosus] Length = 679 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSL+KS+YSAEE+Q+IGM+SIQ+L AQLDGLL Sbjct: 647 LQSLLKSEYSAEEIQNIGMLSIQELQAQLDGLL 679 >ref|XP_020092149.1| conserved oligomeric Golgi complex subunit 3-like isoform X5 [Ananas comosus] Length = 705 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSL+KS+YSAEE+Q+IGM+SIQ+L AQLDGLL Sbjct: 673 LQSLLKSEYSAEEIQNIGMLSIQELQAQLDGLL 705 >ref|XP_020092147.1| conserved oligomeric Golgi complex subunit 3-like isoform X4 [Ananas comosus] Length = 720 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSL+KS+YSAEE+Q+IGM+SIQ+L AQLDGLL Sbjct: 688 LQSLLKSEYSAEEIQNIGMLSIQELQAQLDGLL 720 >ref|XP_020092146.1| conserved oligomeric Golgi complex subunit 3-like isoform X3 [Ananas comosus] Length = 749 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSL+KS+YSAEE+Q+IGM+SIQ+L AQLDGLL Sbjct: 717 LQSLLKSEYSAEEIQNIGMLSIQELQAQLDGLL 749 >ref|XP_020092145.1| conserved oligomeric Golgi complex subunit 3-like isoform X2 [Ananas comosus] Length = 751 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSL+KS+YSAEE+Q+IGM+SIQ+L AQLDGLL Sbjct: 719 LQSLLKSEYSAEEIQNIGMLSIQELQAQLDGLL 751 >ref|XP_020092143.1| conserved oligomeric Golgi complex subunit 3-like isoform X1 [Ananas comosus] ref|XP_020092144.1| conserved oligomeric Golgi complex subunit 3-like isoform X1 [Ananas comosus] Length = 777 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSL+KS+YSAEE+Q+IGM+SIQ+L AQLDGLL Sbjct: 745 LQSLLKSEYSAEEIQNIGMLSIQELQAQLDGLL 777 >gb|OAY85675.1| Conserved oligomeric Golgi complex subunit 3 [Ananas comosus] Length = 777 Score = 54.7 bits (130), Expect = 9e-06 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 444 LQSLIKSDYSAEEMQSIGMVSIQDLHAQLDGLL 346 LQSL+KS+YSAEE+Q+IGM+SIQ+L AQLDGLL Sbjct: 745 LQSLLKSEYSAEEIQNIGMLSIQELQAQLDGLL 777