BLASTX nr result
ID: Ophiopogon24_contig00007126
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00007126 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248636.1| translocase of chloroplast 120, chloroplasti... 79 5e-14 >ref|XP_020248636.1| translocase of chloroplast 120, chloroplastic [Asparagus officinalis] gb|ONK57100.1| uncharacterized protein A4U43_C10F16620 [Asparagus officinalis] Length = 1215 Score = 78.6 bits (192), Expect = 5e-14 Identities = 47/116 (40%), Positives = 56/116 (48%) Frame = -1 Query: 379 EGGVLKLESAAESKEENDVFEEAAMDSESFYTPASAPRHGASDSQESFYTPAYGHRASDS 200 E V + + + EEND FEEA +D Sbjct: 51 EDSVEESKGSVRGSEENDEFEEAELD---------------------------------- 76 Query: 199 QESFYTPAYRHGASDSQDSQETAFDAVESRDGFDGEDGVNPDREDRNLADNLNAIE 32 +ESFYTPAYRH SDSQD QE FD+VES DG DGEDG N DRE + + D+ N E Sbjct: 77 RESFYTPAYRHMGSDSQDLQEADFDSVESADGVDGEDGDNQDREAKEVVDSSNVEE 132