BLASTX nr result
ID: Ophiopogon24_contig00006958
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00006958 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251513.1| tubby-like F-box protein 5 [Asparagus offici... 63 4e-09 >ref|XP_020251513.1| tubby-like F-box protein 5 [Asparagus officinalis] ref|XP_020251515.1| tubby-like F-box protein 5 [Asparagus officinalis] gb|ONK81252.1| uncharacterized protein A4U43_C01F27030 [Asparagus officinalis] Length = 415 Score = 63.2 bits (152), Expect = 4e-09 Identities = 36/64 (56%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Frame = -3 Query: 191 MSFKSIVRELKEMXXXXXXXXXXXXXXG-ALRCPWPNMPHRHLEEEDDREQGRWANLTPE 15 MS KSIVRELKEM G A+RCPWPN H H ++E+ EQG WANL PE Sbjct: 1 MSLKSIVRELKEMRDGFSSSSARRGGIGGAVRCPWPNSRHGH-QDEELYEQGNWANLPPE 59 Query: 14 LLLD 3 LLLD Sbjct: 60 LLLD 63