BLASTX nr result
ID: Ophiopogon24_contig00006948
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00006948 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010905853.1| PREDICTED: F-box protein At2g17036-like [Ela... 57 1e-06 >ref|XP_010905853.1| PREDICTED: F-box protein At2g17036-like [Elaeis guineensis] Length = 419 Score = 56.6 bits (135), Expect = 1e-06 Identities = 37/97 (38%), Positives = 47/97 (48%), Gaps = 1/97 (1%) Frame = +3 Query: 51 FPMNEMRQLYYRKVILSPSLDTAVAIHLATQNPVATQNFKGRLAFARLGGDGTSLSWTDL 230 + + MR YY + IL PS IH + LAFAR G + SWT+L Sbjct: 151 YELEHMRWCYYFRAILHPSSAVVAVIHGGFND----------LAFARAGDE----SWTEL 196 Query: 231 -PSSNYFFNDIIFHKGQLHAVHDEGTLSVYDLENPSA 338 P F DIIF KG LHA+ G L V+DL+ P + Sbjct: 197 QPPQPLTFMDIIFRKGLLHALSTSGALMVFDLDAPGS 233