BLASTX nr result
ID: Ophiopogon24_contig00006946
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00006946 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK73969.1| uncharacterized protein A4U43_C03F1450 [Asparagus... 76 7e-13 ref|XP_020255632.1| apoptotic chromatin condensation inducer in ... 76 7e-13 ref|XP_010437089.1| PREDICTED: leucine-rich repeat extensin-like... 63 2e-09 ref|XP_009342064.1| PREDICTED: apoptotic chromatin condensation ... 65 4e-09 ref|XP_008374317.1| PREDICTED: apoptotic chromatin condensation ... 65 4e-09 ref|XP_021633381.1| apoptotic chromatin condensation inducer in ... 65 5e-09 ref|XP_012064637.1| apoptotic chromatin condensation inducer in ... 65 5e-09 gb|AEW08780.1| hypothetical protein CL1600Contig1_04, partial [P... 59 5e-09 emb|CBI21473.3| unnamed protein product, partial [Vitis vinifera] 64 6e-09 ref|XP_010652843.1| PREDICTED: apoptotic chromatin condensation ... 64 7e-09 ref|XP_002276745.2| PREDICTED: apoptotic chromatin condensation ... 64 7e-09 ref|XP_008338629.1| PREDICTED: apoptotic chromatin condensation ... 64 7e-09 dbj|GAU30455.1| hypothetical protein TSUD_392680 [Trifolium subt... 64 1e-08 ref|XP_006282455.1| apoptotic chromatin condensation inducer in ... 64 1e-08 ref|XP_010916922.1| PREDICTED: apoptotic chromatin condensation ... 64 1e-08 dbj|GAY64515.1| hypothetical protein CUMW_234150 [Citrus unshiu]... 64 1e-08 gb|KDO43726.1| hypothetical protein CISIN_1g004904mg [Citrus sin... 64 1e-08 ref|XP_006428124.1| apoptotic chromatin condensation inducer in ... 64 1e-08 gb|PIN14485.1| Acinus (induces apoptotic chromatin condensation)... 64 1e-08 gb|PIN03015.1| Acinus (induces apoptotic chromatin condensation)... 64 1e-08 >gb|ONK73969.1| uncharacterized protein A4U43_C03F1450 [Asparagus officinalis] Length = 701 Score = 75.9 bits (185), Expect = 7e-13 Identities = 53/120 (44%), Positives = 53/120 (44%) Frame = -3 Query: 498 QEVKMRLEAXXXXXXXXXXXXXXSMAPSFQRQPQAPAAXXXXXXXXXXXXXXXXXXXXXX 319 QEVK RLEA A FQRQ QAP Sbjct: 596 QEVKTRLEAPPQTPAPMKPSPTTPTAAPFQRQAQAPVPSRPNNLTLSNPPPARERLPPPP 655 Query: 318 XXXXXXXXXXXXXXXXXXXXXXPIMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK Sbjct: 656 PLPKKPEPP--------------IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 701 >ref|XP_020255632.1| apoptotic chromatin condensation inducer in the nucleus [Asparagus officinalis] ref|XP_020255633.1| apoptotic chromatin condensation inducer in the nucleus [Asparagus officinalis] Length = 750 Score = 75.9 bits (185), Expect = 7e-13 Identities = 53/120 (44%), Positives = 53/120 (44%) Frame = -3 Query: 498 QEVKMRLEAXXXXXXXXXXXXXXSMAPSFQRQPQAPAAXXXXXXXXXXXXXXXXXXXXXX 319 QEVK RLEA A FQRQ QAP Sbjct: 645 QEVKTRLEAPPQTPAPMKPSPTTPTAAPFQRQAQAPVPSRPNNLTLSNPPPARERLPPPP 704 Query: 318 XXXXXXXXXXXXXXXXXXXXXXPIMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK Sbjct: 705 PLPKKPEPP--------------IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 750 >ref|XP_010437089.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina sativa] Length = 143 Score = 63.2 bits (152), Expect = 2e-09 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLFKKTKA PRIYYLPLSEEQVAAKL A K Sbjct: 107 IVTLDDLFKKTKAIPRIYYLPLSEEQVAAKLAANNNK 143 >ref|XP_009342064.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus [Pyrus x bretschneideri] Length = 744 Score = 65.1 bits (157), Expect = 4e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTK+TPRIYYLPLSEEQVA KL A+QG+ Sbjct: 704 IVTLDDLFRKTKSTPRIYYLPLSEEQVAEKLAAQQGR 740 >ref|XP_008374317.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus [Malus domestica] Length = 749 Score = 65.1 bits (157), Expect = 4e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTK+TPRIYYLPLSEEQVA KL A+QG+ Sbjct: 709 IVTLDDLFRKTKSTPRIYYLPLSEEQVAEKLAAQQGR 745 >ref|XP_021633381.1| apoptotic chromatin condensation inducer in the nucleus-like [Manihot esculenta] gb|OAY33371.1| hypothetical protein MANES_13G090100 [Manihot esculenta] Length = 694 Score = 64.7 bits (156), Expect = 5e-09 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTKATPRIYYLPLSEEQVAAKL AE+GK Sbjct: 655 IVTLDDLFRKTKATPRIYYLPLSEEQVAAKL-AERGK 690 >ref|XP_012064637.1| apoptotic chromatin condensation inducer in the nucleus [Jatropha curcas] gb|KDP46899.1| hypothetical protein JCGZ_24108 [Jatropha curcas] Length = 707 Score = 64.7 bits (156), Expect = 5e-09 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTKATPRIYYLPLSEEQVAAKL AE+GK Sbjct: 668 IVTLDDLFRKTKATPRIYYLPLSEEQVAAKL-AERGK 703 >gb|AEW08780.1| hypothetical protein CL1600Contig1_04, partial [Pinus radiata] gb|AFG54730.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54731.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54732.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54733.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54734.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54735.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54736.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54737.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54738.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54739.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54740.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54741.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54742.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54743.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54744.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] gb|AFG54745.1| hypothetical protein CL1600Contig1_04, partial [Pinus taeda] Length = 52 Score = 59.3 bits (142), Expect = 5e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAE 148 ++TLDDLFKKT+ +PRIYYLPLSEEQVAAKL A+ Sbjct: 13 VVTLDDLFKKTRTSPRIYYLPLSEEQVAAKLAAK 46 >emb|CBI21473.3| unnamed protein product, partial [Vitis vinifera] Length = 413 Score = 64.3 bits (155), Expect = 6e-09 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTKATPRIYYLPLSEEQVAAKL+A QGK Sbjct: 374 IVTLDDLFQKTKATPRIYYLPLSEEQVAAKLKA-QGK 409 >ref|XP_010652843.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus isoform X2 [Vitis vinifera] Length = 662 Score = 64.3 bits (155), Expect = 7e-09 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTKATPRIYYLPLSEEQVAAKL+A QGK Sbjct: 623 IVTLDDLFQKTKATPRIYYLPLSEEQVAAKLKA-QGK 658 >ref|XP_002276745.2| PREDICTED: apoptotic chromatin condensation inducer in the nucleus isoform X1 [Vitis vinifera] Length = 691 Score = 64.3 bits (155), Expect = 7e-09 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTKATPRIYYLPLSEEQVAAKL+A QGK Sbjct: 623 IVTLDDLFQKTKATPRIYYLPLSEEQVAAKLKA-QGK 658 >ref|XP_008338629.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus-like [Malus domestica] Length = 744 Score = 64.3 bits (155), Expect = 7e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTK+TPRIYYLPLS+EQVA KL A+QG+ Sbjct: 704 IVTLDDLFRKTKSTPRIYYLPLSDEQVAEKLSAQQGR 740 >dbj|GAU30455.1| hypothetical protein TSUD_392680 [Trifolium subterraneum] Length = 712 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTKATPRIYYLPLSEEQVAAKL A QGK Sbjct: 673 IVTLDDLFRKTKATPRIYYLPLSEEQVAAKL-AAQGK 708 >ref|XP_006282455.1| apoptotic chromatin condensation inducer in the nucleus [Capsella rubella] ref|XP_023634030.1| apoptotic chromatin condensation inducer in the nucleus [Capsella rubella] gb|EOA15353.1| hypothetical protein CARUB_v10004348mg [Capsella rubella] Length = 640 Score = 63.5 bits (153), Expect = 1e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLFKKTKA PRIYYLPLSEEQVAAKL A+ K Sbjct: 604 IVTLDDLFKKTKAIPRIYYLPLSEEQVAAKLAAKNNK 640 >ref|XP_010916922.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus-like isoform X1 [Elaeis guineensis] Length = 655 Score = 63.5 bits (153), Expect = 1e-08 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 +MTLDDLFKKTKA+PRIYYLPLSEEQV+AKL A QGK Sbjct: 616 VMTLDDLFKKTKASPRIYYLPLSEEQVSAKL-AAQGK 651 >dbj|GAY64515.1| hypothetical protein CUMW_234150 [Citrus unshiu] dbj|GAY64516.1| hypothetical protein CUMW_234150 [Citrus unshiu] Length = 724 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQA 151 I+TLDDLF+KTKATPRIYYLPLSEEQVAAKL+A Sbjct: 685 IVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEA 717 >gb|KDO43726.1| hypothetical protein CISIN_1g004904mg [Citrus sinensis] Length = 724 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQA 151 I+TLDDLF+KTKATPRIYYLPLSEEQVAAKL+A Sbjct: 685 IVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEA 717 >ref|XP_006428124.1| apoptotic chromatin condensation inducer in the nucleus [Citrus clementina] ref|XP_006464290.1| PREDICTED: apoptotic chromatin condensation inducer in the nucleus [Citrus sinensis] gb|ESR41364.1| hypothetical protein CICLE_v10025009mg [Citrus clementina] Length = 724 Score = 63.5 bits (153), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQA 151 I+TLDDLF+KTKATPRIYYLPLSEEQVAAKL+A Sbjct: 685 IVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEA 717 >gb|PIN14485.1| Acinus (induces apoptotic chromatin condensation) [Handroanthus impetiginosus] Length = 760 Score = 63.5 bits (153), Expect = 1e-08 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTKATPRIYYLPLS+EQVAAKL+A QGK Sbjct: 721 IVTLDDLFRKTKATPRIYYLPLSDEQVAAKLKA-QGK 756 >gb|PIN03015.1| Acinus (induces apoptotic chromatin condensation) [Handroanthus impetiginosus] Length = 760 Score = 63.5 bits (153), Expect = 1e-08 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -3 Query: 249 IMTLDDLFKKTKATPRIYYLPLSEEQVAAKLQAEQGK 139 I+TLDDLF+KTKATPRIYYLPLS+EQVAAKL+A QGK Sbjct: 721 IVTLDDLFRKTKATPRIYYLPLSDEQVAAKLKA-QGK 756