BLASTX nr result
ID: Ophiopogon24_contig00006792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00006792 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020254828.1| protein SRC2-like [Asparagus officinalis] 57 6e-07 ref|XP_020244194.1| protein SRC2-like [Asparagus officinalis] 57 1e-06 >ref|XP_020254828.1| protein SRC2-like [Asparagus officinalis] Length = 261 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 405 DKKAGPPAQFVGYQVRKNSGKAKGVLNISYKFGD 304 DKK P AQFV YQVRKN+GKAKGVLNISYKFG+ Sbjct: 106 DKKV-PAAQFVSYQVRKNTGKAKGVLNISYKFGE 138 >ref|XP_020244194.1| protein SRC2-like [Asparagus officinalis] Length = 346 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 405 DKKAGPPAQFVGYQVRKNSGKAKGVLNISYKFGD 304 D+K PAQFV YQVR++SG+AKGVLN+SYKFGD Sbjct: 113 DEKKAVPAQFVSYQVRRSSGEAKGVLNLSYKFGD 146