BLASTX nr result
ID: Ophiopogon24_contig00006724
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00006724 (698 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010940009.1| PREDICTED: wee1-like protein kinase [Elaeis ... 60 6e-07 >ref|XP_010940009.1| PREDICTED: wee1-like protein kinase [Elaeis guineensis] Length = 507 Score = 60.5 bits (145), Expect = 6e-07 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -1 Query: 143 KENIACPKSPEKSV--RTKRHRKEGSHCNSLFANDHCLQQAGDLQLD 9 KENI CPKSPEKS+ R KR+ ++GS CNSL N HC +Q ++QLD Sbjct: 115 KENIPCPKSPEKSINGRKKRNNQDGSPCNSLSTNLHCTEQGAEVQLD 161