BLASTX nr result
ID: Ophiopogon24_contig00006649
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00006649 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245913.1| DExH-box ATP-dependent RNA helicase DExH14 [... 67 6e-10 emb|CDP17715.1| unnamed protein product [Coffea canephora] 57 2e-06 >ref|XP_020245913.1| DExH-box ATP-dependent RNA helicase DExH14 [Asparagus officinalis] gb|ONK57593.1| uncharacterized protein A4U43_C09F2080 [Asparagus officinalis] Length = 2081 Score = 67.4 bits (163), Expect = 6e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 LPSTPINLQETRLILVSDCYLGFEQEYPIEEL 97 LPSTPINLQETRLILVSDCYLGFEQEYPIEE+ Sbjct: 2050 LPSTPINLQETRLILVSDCYLGFEQEYPIEEV 2081 >emb|CDP17715.1| unnamed protein product [Coffea canephora] Length = 2110 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 LPSTPINLQETRLILVSDCYLGFEQEYPIE 91 +PST +NLQE RLILVSDCYLG+EQEYPIE Sbjct: 2081 IPSTQVNLQEMRLILVSDCYLGYEQEYPIE 2110