BLASTX nr result
ID: Ophiopogon24_contig00006567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00006567 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020270052.1| LOW QUALITY PROTEIN: glutamate decarboxylase... 55 8e-06 >ref|XP_020270052.1| LOW QUALITY PROTEIN: glutamate decarboxylase 1-like [Asparagus officinalis] Length = 484 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = -3 Query: 390 LQPEKIDEGVVVEKKSVAEIEKGIATYWKRQVDSKKTNGIC 268 ++ EK DEGVVV++KSV E+E+ + YWKR D KKT+G+C Sbjct: 444 VKAEKTDEGVVVKEKSVMEVEQEVVGYWKRFADRKKTSGVC 484