BLASTX nr result
ID: Ophiopogon24_contig00006477
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00006477 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244023.1| WD repeat domain-containing protein 83 [Aspa... 67 2e-10 ref|XP_008781444.1| PREDICTED: WD repeat domain-containing prote... 65 1e-09 ref|XP_010930959.1| PREDICTED: WD repeat domain-containing prote... 64 1e-09 ref|XP_009404349.1| PREDICTED: WD repeat domain-containing prote... 60 3e-08 dbj|GAY60245.1| hypothetical protein CUMW_200470 [Citrus unshiu] 54 3e-07 dbj|GAY60248.1| hypothetical protein CUMW_200490 [Citrus unshiu] 55 3e-07 gb|OWM91395.1| hypothetical protein CDL15_Pgr017313 [Punica gran... 58 3e-07 gb|PKA61518.1| Protein Mut11 [Apostasia shenzhenica] 57 6e-07 ref|XP_010260983.1| PREDICTED: WD repeat domain-containing prote... 57 8e-07 ref|XP_012075294.1| WD repeat domain-containing protein 83 [Jatr... 57 8e-07 ref|XP_020686887.1| WD repeat domain-containing protein 83 isofo... 56 9e-07 dbj|GAV80405.1| WD40 domain-containing protein [Cephalotus folli... 56 1e-06 gb|KOM30623.1| hypothetical protein LR48_Vigan01g017700 [Vigna a... 56 1e-06 ref|XP_010088736.2| WD repeat domain-containing protein 83 [Moru... 56 1e-06 gb|EXB36917.1| WD repeat domain-containing protein 83 [Morus not... 56 1e-06 ref|XP_017422390.1| PREDICTED: WD repeat domain-containing prote... 56 1e-06 ref|XP_014507658.1| WD repeat domain-containing protein 83 [Vign... 56 1e-06 ref|XP_020686870.1| WD repeat domain-containing protein 83 isofo... 56 1e-06 gb|OMO83679.1| hypothetical protein COLO4_22379 [Corchorus olito... 56 1e-06 ref|XP_018824959.1| PREDICTED: WD repeat domain-containing prote... 56 2e-06 >ref|XP_020244023.1| WD repeat domain-containing protein 83 [Asparagus officinalis] ref|XP_020244025.1| WD repeat domain-containing protein 83 [Asparagus officinalis] ref|XP_020244026.1| WD repeat domain-containing protein 83 [Asparagus officinalis] ref|XP_020244027.1| WD repeat domain-containing protein 83 [Asparagus officinalis] gb|ONK60304.1| uncharacterized protein A4U43_C08F16740 [Asparagus officinalis] Length = 303 Score = 67.0 bits (162), Expect = 2e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 277 SSTAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 SS+AA LLPRKEANVLKGHEGAVLAVRFNGDGNY Sbjct: 3 SSSAADLLPRKEANVLKGHEGAVLAVRFNGDGNY 36 >ref|XP_008781444.1| PREDICTED: WD repeat domain-containing protein 83 [Phoenix dactylifera] Length = 304 Score = 64.7 bits (156), Expect = 1e-09 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 265 MASGSSTAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 MAS SS+A+ L PRKEANVLKGHEGAVLAVRFNGDGNY Sbjct: 1 MASSSSSASEL-PRKEANVLKGHEGAVLAVRFNGDGNY 37 >ref|XP_010930959.1| PREDICTED: WD repeat domain-containing protein 83 [Elaeis guineensis] Length = 304 Score = 64.3 bits (155), Expect = 1e-09 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 265 MASGSSTAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 MAS SS+A+ L PRKEANVLKGHEGAVLAVRFNGDGNY Sbjct: 1 MASSSSSASGL-PRKEANVLKGHEGAVLAVRFNGDGNY 37 >ref|XP_009404349.1| PREDICTED: WD repeat domain-containing protein 83 [Musa acuminata subsp. malaccensis] Length = 304 Score = 60.5 bits (145), Expect = 3e-08 Identities = 31/38 (81%), Positives = 31/38 (81%) Frame = +1 Query: 265 MASGSSTAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 MASG S L PRKEANVLKGHEG VLAVRFNGDGNY Sbjct: 1 MASGGSGGVEL-PRKEANVLKGHEGPVLAVRFNGDGNY 37 >dbj|GAY60245.1| hypothetical protein CUMW_200470 [Citrus unshiu] Length = 70 Score = 54.3 bits (129), Expect = 3e-07 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LPR EANVLKGH+GAVLA RFNGDGNY Sbjct: 6 LPRTEANVLKGHDGAVLAARFNGDGNY 32 >dbj|GAY60248.1| hypothetical protein CUMW_200490 [Citrus unshiu] Length = 115 Score = 55.5 bits (132), Expect = 3e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LPR EANVLKGHEGAVLA RFNGDGNY Sbjct: 6 LPRTEANVLKGHEGAVLAARFNGDGNY 32 >gb|OWM91395.1| hypothetical protein CDL15_Pgr017313 [Punica granatum] gb|PKI79339.1| hypothetical protein CRG98_000284 [Punica granatum] Length = 299 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LPRKEANVLKGHEGAVLA RFNGDGNY Sbjct: 6 LPRKEANVLKGHEGAVLAARFNGDGNY 32 >gb|PKA61518.1| Protein Mut11 [Apostasia shenzhenica] Length = 306 Score = 57.0 bits (136), Expect = 6e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +1 Query: 271 SGSSTAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 +G +AA L PRKE +VLKGHEGAVLAVRFNGDGNY Sbjct: 2 AGEGSAAEL-PRKEVDVLKGHEGAVLAVRFNGDGNY 36 >ref|XP_010260983.1| PREDICTED: WD repeat domain-containing protein 83 [Nelumbo nucifera] Length = 299 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LPRKEANVL+GHEGAVLA RFNGDGNY Sbjct: 6 LPRKEANVLRGHEGAVLAARFNGDGNY 32 >ref|XP_012075294.1| WD repeat domain-containing protein 83 [Jatropha curcas] ref|XP_012075295.1| WD repeat domain-containing protein 83 [Jatropha curcas] ref|XP_020535935.1| WD repeat domain-containing protein 83 [Jatropha curcas] gb|KDP35304.1| hypothetical protein JCGZ_09463 [Jatropha curcas] Length = 299 Score = 56.6 bits (135), Expect = 8e-07 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LP+KEANVLKGHEGAVLA RFNGDGNY Sbjct: 6 LPKKEANVLKGHEGAVLAARFNGDGNY 32 >ref|XP_020686887.1| WD repeat domain-containing protein 83 isoform X2 [Dendrobium catenatum] Length = 261 Score = 56.2 bits (134), Expect = 9e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 268 ASGSSTAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 +SGSS+ LPRKEA VL+GHEGAVLA RFNGDGNY Sbjct: 3 SSGSSSE---LPRKEAGVLRGHEGAVLAARFNGDGNY 36 >dbj|GAV80405.1| WD40 domain-containing protein [Cephalotus follicularis] Length = 220 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +1 Query: 241 GKGEVTRKMASGSSTAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 G+ E R+ + LPRKEANVLKGHEGAVLA RFN DGNY Sbjct: 11 GERERERERERERGMSVSDLPRKEANVLKGHEGAVLAARFNADGNY 56 >gb|KOM30623.1| hypothetical protein LR48_Vigan01g017700 [Vigna angularis] Length = 277 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LPRKE NVLKGHEGAVLA RFNGDGNY Sbjct: 6 LPRKEVNVLKGHEGAVLAARFNGDGNY 32 >ref|XP_010088736.2| WD repeat domain-containing protein 83 [Morus notabilis] Length = 283 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LPRKE NVLKGHEGAVLA RFNGDGNY Sbjct: 6 LPRKETNVLKGHEGAVLAARFNGDGNY 32 >gb|EXB36917.1| WD repeat domain-containing protein 83 [Morus notabilis] Length = 291 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LPRKE NVLKGHEGAVLA RFNGDGNY Sbjct: 6 LPRKETNVLKGHEGAVLAARFNGDGNY 32 >ref|XP_017422390.1| PREDICTED: WD repeat domain-containing protein 83 [Vigna angularis] dbj|BAT73297.1| hypothetical protein VIGAN_01077000 [Vigna angularis var. angularis] Length = 299 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LPRKE NVLKGHEGAVLA RFNGDGNY Sbjct: 6 LPRKEVNVLKGHEGAVLAARFNGDGNY 32 >ref|XP_014507658.1| WD repeat domain-containing protein 83 [Vigna radiata var. radiata] Length = 299 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 298 LPRKEANVLKGHEGAVLAVRFNGDGNY 378 LPRKE NVLKGHEGAVLA RFNGDGNY Sbjct: 6 LPRKEVNVLKGHEGAVLAARFNGDGNY 32 >ref|XP_020686870.1| WD repeat domain-containing protein 83 isoform X1 [Dendrobium catenatum] ref|XP_020686878.1| WD repeat domain-containing protein 83 isoform X1 [Dendrobium catenatum] gb|PKU70325.1| Protein pleiotropic regulatory locus 1 [Dendrobium catenatum] Length = 303 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 268 ASGSSTAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 +SGSS+ LPRKEA VL+GHEGAVLA RFNGDGNY Sbjct: 3 SSGSSSE---LPRKEAGVLRGHEGAVLAARFNGDGNY 36 >gb|OMO83679.1| hypothetical protein COLO4_22379 [Corchorus olitorius] Length = 333 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/44 (68%), Positives = 30/44 (68%) Frame = +1 Query: 247 GEVTRKMASGSSTAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 GE RK S LPRKEANVLKGHEGAVLA RFN DGNY Sbjct: 27 GETERKRNMSVSE----LPRKEANVLKGHEGAVLAARFNSDGNY 66 >ref|XP_018824959.1| PREDICTED: WD repeat domain-containing protein 83 [Juglans regia] Length = 300 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 283 TAAPLLPRKEANVLKGHEGAVLAVRFNGDGNY 378 +A +LPRKEANVL+GHEGAVLA RFN DGNY Sbjct: 2 SAIDVLPRKEANVLRGHEGAVLAARFNSDGNY 33