BLASTX nr result
ID: Ophiopogon24_contig00006074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00006074 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252786.1| alpha-galactosidase 3 [Asparagus officinalis... 54 5e-06 >ref|XP_020252786.1| alpha-galactosidase 3 [Asparagus officinalis] gb|ONK77145.1| uncharacterized protein A4U43_C02F3560 [Asparagus officinalis] Length = 423 Score = 54.3 bits (129), Expect = 5e-06 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = -1 Query: 363 KHENLGESITGAFGCRVDAHDCEMYILTPASHA 265 KHENL E++ G+FG R+D+HDC+MYI TPA+++ Sbjct: 388 KHENLAENVAGSFGARLDSHDCKMYIFTPATYS 420