BLASTX nr result
ID: Ophiopogon24_contig00005930
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00005930 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIO34362.1| hypothetical protein AB205_0070660 [Rana catesbei... 54 1e-06 gb|KOB69042.1| putative CCR4-NOT transcription complex, subunit ... 57 1e-06 ref|XP_013075595.1| PREDICTED: CCR4-NOT transcription complex su... 54 1e-06 gb|EMS63708.1| hypothetical protein TRIUR3_20235 [Triticum urartu] 56 2e-06 ref|XP_001870212.1| Cnot1 protein [Culex quinquefasciatus] >gi|1... 54 2e-06 ref|XP_023335638.1| CCR4-NOT transcription complex subunit 1-lik... 54 2e-06 ref|XP_002433313.1| CCR4-not transcription complex, putative, pa... 54 2e-06 ref|XP_013730441.1| CCR4-NOT transcription complex subunit 1-lik... 54 2e-06 gb|PIK61971.1| putative CCR4-not transcription complex [Apostich... 53 3e-06 ref|XP_010146022.1| PREDICTED: CCR4-NOT transcription complex su... 54 3e-06 gb|AAH94620.1| Cnot1 protein, partial [Mus musculus] 54 4e-06 gb|OAD01611.1| Not1 transcription factor [Mucor circinelloides f... 55 4e-06 dbj|GAN00649.1| not1-domain-containing protein [Mucor ambiguus] 55 4e-06 ref|XP_018493694.1| PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra... 55 4e-06 ref|XP_006071157.1| PREDICTED: CCR4-NOT transcription complex su... 54 5e-06 ref|XP_010022545.1| PREDICTED: CCR4-NOT transcription complex su... 54 6e-06 emb|CEP14955.1| hypothetical protein [Parasitella parasitica] 55 6e-06 emb|CBI23414.3| unnamed protein product, partial [Vitis vinifera] 53 6e-06 gb|EHB00682.1| CCR4-NOT transcription complex subunit 1 [Heteroc... 54 6e-06 gb|AFK35030.1| unknown [Medicago truncatula] 54 7e-06 >gb|PIO34362.1| hypothetical protein AB205_0070660 [Rana catesbeiana] Length = 117 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 44 QITRVLLERLIVNRPHPWGLLITFIELIK 72 >gb|KOB69042.1| putative CCR4-NOT transcription complex, subunit 1 isoform a [Operophtera brumata] Length = 2166 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIKTVYT 368 QITR++LE LIVNRPHPW LLITFIELIK YT Sbjct: 2117 QITRMLLERLIVNRPHPWGLLITFIELIKNPYT 2149 >ref|XP_013075595.1| PREDICTED: CCR4-NOT transcription complex subunit 1-like, partial [Biomphalaria glabrata] Length = 128 Score = 53.9 bits (128), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 51 QITRVLLERLIVNRPHPWGLLITFIELIK 79 >gb|EMS63708.1| hypothetical protein TRIUR3_20235 [Triticum urartu] Length = 2376 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIKTVYTQQ 374 QITRV+LE LIVNRPHPW LLITFIELIK ++Q+ Sbjct: 2296 QITRVLLERLIVNRPHPWGLLITFIELIKADHSQR 2330 >ref|XP_001870212.1| Cnot1 protein [Culex quinquefasciatus] gb|EDS32359.1| Cnot1 protein [Culex quinquefasciatus] Length = 138 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 47 QITRVLLERLIVNRPHPWGLLITFIELIK 75 >ref|XP_023335638.1| CCR4-NOT transcription complex subunit 1-like [Eurytemora affinis] Length = 140 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 65 QITRVLLERLIVNRPHPWGLLITFIELIK 93 >ref|XP_002433313.1| CCR4-not transcription complex, putative, partial [Pediculus humanus corporis] gb|EEB20575.1| CCR4-not transcription complex, putative, partial [Pediculus humanus corporis] Length = 149 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 72 QITRVLLERLIVNRPHPWGLLITFIELIK 100 >ref|XP_013730441.1| CCR4-NOT transcription complex subunit 1-like [Brassica napus] Length = 153 Score = 53.9 bits (128), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 76 QITRVLLERLIVNRPHPWGLLITFIELIK 104 >gb|PIK61971.1| putative CCR4-not transcription complex [Apostichopus japonicus] Length = 116 Score = 52.8 bits (125), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELI+ Sbjct: 35 QITRVLLERLIVNRPHPWGLLITFIELIR 63 >ref|XP_010146022.1| PREDICTED: CCR4-NOT transcription complex subunit 1, partial [Eurypyga helias] Length = 175 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 102 QITRVLLERLIVNRPHPWGLLITFIELIK 130 >gb|AAH94620.1| Cnot1 protein, partial [Mus musculus] Length = 188 Score = 53.9 bits (128), Expect = 4e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 115 QITRVLLERLIVNRPHPWGLLITFIELIK 143 >gb|OAD01611.1| Not1 transcription factor [Mucor circinelloides f. lusitanicus CBS 277.49] Length = 1603 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 240 VQKKLNHST*QITRVILECLIVNRPHPW*LLITFIELIK 356 V+ K + + QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 1538 VESKKDIAKEQITRVLLERLIVNRPHPWGLLITFIELIK 1576 >dbj|GAN00649.1| not1-domain-containing protein [Mucor ambiguus] Length = 1870 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 240 VQKKLNHST*QITRVILECLIVNRPHPW*LLITFIELIK 356 V+ K + + QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 1800 VESKKDIAKEQITRVLLERLIVNRPHPWGLLITFIELIK 1838 >ref|XP_018493694.1| PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT transcription complex subunit 1 [Galendromus occidentalis] Length = 2284 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 255 NHST*QITRVILECLIVNRPHPW*LLITFIELIK 356 NH QITRV+LE LIVNRPHPW LL+TF+EL+K Sbjct: 2212 NHLREQITRVLLERLIVNRPHPWGLLVTFVELLK 2245 >ref|XP_006071157.1| PREDICTED: CCR4-NOT transcription complex subunit 1-like [Bubalus bubalis] Length = 242 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 169 QITRVLLEWLIVNRPHPWGLLITFIELIK 197 >ref|XP_010022545.1| PREDICTED: CCR4-NOT transcription complex subunit 1 [Nestor notabilis] Length = 223 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 150 QITRVLLERLIVNRPHPWGLLITFIELIK 178 >emb|CEP14955.1| hypothetical protein [Parasitella parasitica] Length = 1871 Score = 54.7 bits (130), Expect = 6e-06 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 240 VQKKLNHST*QITRVILECLIVNRPHPW*LLITFIELIK 356 V+ K + QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 1801 VESKQEIAKEQITRVLLERLIVNRPHPWGLLITFIELIK 1839 >emb|CBI23414.3| unnamed protein product, partial [Vitis vinifera] Length = 171 Score = 53.1 bits (126), Expect = 6e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW +LITFIELIK Sbjct: 98 QITRVLLERLIVNRPHPWGILITFIELIK 126 >gb|EHB00682.1| CCR4-NOT transcription complex subunit 1 [Heterocephalus glaber] Length = 239 Score = 53.9 bits (128), Expect = 6e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIK 356 QITRV+LE LIVNRPHPW LLITFIELIK Sbjct: 166 QITRVLLERLIVNRPHPWGLLITFIELIK 194 >gb|AFK35030.1| unknown [Medicago truncatula] Length = 352 Score = 54.3 bits (129), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 270 QITRVILECLIVNRPHPW*LLITFIELIKTV 362 QITRV+LE LIVNRPHPW LLITFIELIK + Sbjct: 278 QITRVLLERLIVNRPHPWGLLITFIELIKNL 308