BLASTX nr result
ID: Ophiopogon24_contig00005811
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00005811 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63007.1| uncharacterized protein A4U43_C07F10420 [Asparagu... 80 2e-16 ref|XP_020276010.1| NAD(P)H-quinone oxidoreductase subunit S, ch... 80 7e-16 ref|XP_010909311.1| PREDICTED: NAD(P)H-quinone oxidoreductase su... 48 3e-06 >gb|ONK63007.1| uncharacterized protein A4U43_C07F10420 [Asparagus officinalis] Length = 139 Score = 80.1 bits (196), Expect = 2e-16 Identities = 40/53 (75%), Positives = 42/53 (79%) Frame = -3 Query: 201 MAISTPIQTIQNPLLNKSHFLHKTHLSYHPSPSPRTIFIPHAKFNLSEIMGGQ 43 MA S PIQTIQNPLLNK+ LHKTHLS S S R IF PHAKFNLSEIMGG+ Sbjct: 1 MATSIPIQTIQNPLLNKTQLLHKTHLSAPSSSSHRLIFTPHAKFNLSEIMGGR 53 >ref|XP_020276010.1| NAD(P)H-quinone oxidoreductase subunit S, chloroplastic [Asparagus officinalis] Length = 229 Score = 80.1 bits (196), Expect(2) = 7e-16 Identities = 40/53 (75%), Positives = 42/53 (79%) Frame = -3 Query: 201 MAISTPIQTIQNPLLNKSHFLHKTHLSYHPSPSPRTIFIPHAKFNLSEIMGGQ 43 MA S PIQTIQNPLLNK+ LHKTHLS S S R IF PHAKFNLSEIMGG+ Sbjct: 1 MATSIPIQTIQNPLLNKTQLLHKTHLSAPSSSSHRLIFTPHAKFNLSEIMGGR 53 Score = 31.2 bits (69), Expect(2) = 7e-16 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 44 RGLCNGEIGLQKEL 3 RGLCNGE GLQKEL Sbjct: 53 RGLCNGEAGLQKEL 66 >ref|XP_010909311.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit S, chloroplastic [Elaeis guineensis] ref|XP_010909312.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit S, chloroplastic [Elaeis guineensis] ref|XP_010909313.1| PREDICTED: NAD(P)H-quinone oxidoreductase subunit S, chloroplastic [Elaeis guineensis] Length = 222 Score = 48.1 bits (113), Expect(2) = 3e-06 Identities = 25/53 (47%), Positives = 35/53 (66%) Frame = -3 Query: 201 MAISTPIQTIQNPLLNKSHFLHKTHLSYHPSPSPRTIFIPHAKFNLSEIMGGQ 43 MA S P+Q IQNP+L +S FL KT S PS + ++ P AK LS+++GG+ Sbjct: 1 MASSIPVQIIQNPVLGRSSFLRKTRHSSIPSRTTTSV-TPSAKLQLSDLLGGR 52 Score = 30.4 bits (67), Expect(2) = 3e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 44 RGLCNGEIGLQKEL 3 RGLCNGE+GL KEL Sbjct: 52 RGLCNGEVGLYKEL 65