BLASTX nr result
ID: Ophiopogon24_contig00005613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00005613 (787 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OVA00305.1| Band 7 protein [Macleaya cordata] 102 4e-22 ref|XP_010925060.1| PREDICTED: hypersensitive-induced response p... 101 1e-21 gb|OAY77777.1| Hypersensitive-induced response protein 1 [Ananas... 102 1e-21 ref|XP_006842113.1| hypersensitive-induced response protein 1 [A... 100 4e-21 ref|XP_008808433.1| PREDICTED: hypersensitive-induced response p... 99 6e-21 ref|XP_020241121.1| hypersensitive-induced response protein 1-li... 99 8e-21 ref|XP_020692304.1| hypersensitive-induced response protein 1 [D... 98 2e-20 ref|XP_009407283.1| PREDICTED: hypersensitive-induced response p... 98 2e-20 ref|XP_002276517.1| PREDICTED: hypersensitive-induced response p... 98 2e-20 ref|XP_010459268.1| PREDICTED: hypersensitive-induced response p... 97 3e-20 gb|KDO82770.1| hypothetical protein CISIN_1g0229932mg, partial [... 91 3e-20 ref|XP_020098132.1| hypersensitive-induced response protein 1-li... 97 4e-20 ref|XP_009410754.1| PREDICTED: hypersensitive-induced response p... 97 4e-20 ref|XP_018485848.1| PREDICTED: hypersensitive-induced response p... 97 4e-20 emb|CBI32018.3| unnamed protein product, partial [Vitis vinifera] 98 7e-20 gb|KXG25127.2| hypothetical protein SORBI_3007G120401 [Sorghum b... 98 8e-20 emb|CDP02195.1| unnamed protein product [Coffea canephora] 96 9e-20 gb|OEL13374.1| Hypersensitive-induced response protein 1 [Dichan... 96 9e-20 gb|ONK59367.1| uncharacterized protein A4U43_C08F5710 [Asparagus... 99 1e-19 dbj|GAU31395.1| hypothetical protein TSUD_370440, partial [Trifo... 92 1e-19 >gb|OVA00305.1| Band 7 protein [Macleaya cordata] Length = 287 Score = 102 bits (254), Expect = 4e-22 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCL-----NVAIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QALCC+ NVAI+E+FGKF+DVLEPGCHFLPWCFG IAG LSLR+QQLDV CET Sbjct: 1 MGQALCCVQVDQSNVAIKETFGKFDDVLEPGCHFLPWCFGSQIAGQLSLRLQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_010925060.1| PREDICTED: hypersensitive-induced response protein 1 [Elaeis guineensis] Length = 286 Score = 101 bits (251), Expect = 1e-21 Identities = 47/63 (74%), Positives = 52/63 (82%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QALCCL V AI+E+FG+F DVL+PGCHFLPWC G+ IAGYLSLRVQQLDV CET Sbjct: 1 MGQALCCLQVEQSTVAIKETFGRFTDVLDPGCHFLPWCLGQQIAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >gb|OAY77777.1| Hypersensitive-induced response protein 1 [Ananas comosus] Length = 332 Score = 102 bits (253), Expect = 1e-21 Identities = 46/66 (69%), Positives = 54/66 (81%), Gaps = 5/66 (7%) Frame = -1 Query: 547 GEDMRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVH 383 G+DM QA CC+ V AI+E+FG+F++VLEPGCH LPWC G+ IAGYLSLRVQQLDV Sbjct: 6 GKDMGQAFCCIQVDQSTVAIKETFGRFDEVLEPGCHLLPWCLGKQIAGYLSLRVQQLDVR 65 Query: 382 CETKTK 365 CETKTK Sbjct: 66 CETKTK 71 >ref|XP_006842113.1| hypersensitive-induced response protein 1 [Amborella trichopoda] gb|ERN03788.1| hypothetical protein AMTR_s00078p00099060 [Amborella trichopoda] Length = 284 Score = 99.8 bits (247), Expect = 4e-21 Identities = 46/63 (73%), Positives = 49/63 (77%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCL-----NVAIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M Q CCL NVAI E FGKF+DVLEPGCHFLPWC G +AGYL+LRVQQLDV CET Sbjct: 1 MGQLFCCLQVDQSNVAIREQFGKFDDVLEPGCHFLPWCLGSQVAGYLTLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_008808433.1| PREDICTED: hypersensitive-induced response protein 1 [Phoenix dactylifera] Length = 286 Score = 99.4 bits (246), Expect = 6e-21 Identities = 47/63 (74%), Positives = 51/63 (80%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QALCCL V AI+E+FG+F DVLEPGCH LPWC G+ IAGYLSLRVQQLDV CET Sbjct: 1 MGQALCCLQVDQSTVAIKETFGRFTDVLEPGCHCLPWCLGQQIAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_020241121.1| hypersensitive-induced response protein 1-like [Asparagus officinalis] ref|XP_020241122.1| hypersensitive-induced response protein 1-like [Asparagus officinalis] ref|XP_020241123.1| hypersensitive-induced response protein 1-like [Asparagus officinalis] Length = 285 Score = 99.0 bits (245), Expect = 8e-21 Identities = 47/63 (74%), Positives = 52/63 (82%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QALCCL V AI+E+FGKF+DVLEPGCH LPW FG+ +AGYLSLRVQQLDV CET Sbjct: 1 MGQALCCLQVDQSTVAIKETFGKFDDVLEPGCHCLPWIFGQQVAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_020692304.1| hypersensitive-induced response protein 1 [Dendrobium catenatum] ref|XP_020692307.1| hypersensitive-induced response protein 1 [Dendrobium catenatum] gb|PKU72553.1| Hypersensitive-induced response protein 1 [Dendrobium catenatum] Length = 285 Score = 97.8 bits (242), Expect = 2e-20 Identities = 45/63 (71%), Positives = 52/63 (82%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M Q LCCL V AI+E+FGKF+DVLEPGCHF+PW G+++AGYLSLRVQQLDV CET Sbjct: 1 MGQTLCCLQVEQSTVAIKETFGKFDDVLEPGCHFVPWILGKNVAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_009407283.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X2 [Musa acuminata subsp. malaccensis] ref|XP_018683826.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 285 Score = 97.8 bits (242), Expect = 2e-20 Identities = 45/63 (71%), Positives = 50/63 (79%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QA CC+ V A+ E+FGKF+ VLEPGCHFLPWC G+ IAGYLSLRVQQLDV CET Sbjct: 1 MGQAFCCIQVDQSTVAMRETFGKFDHVLEPGCHFLPWCLGKQIAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_002276517.1| PREDICTED: hypersensitive-induced response protein 2 [Vitis vinifera] Length = 286 Score = 97.8 bits (242), Expect = 2e-20 Identities = 45/63 (71%), Positives = 51/63 (80%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCL-----NVAIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QA CC+ NVAI+E FGKF++VLEPGCH LPWCFG +AG+LSLRVQQLDV CET Sbjct: 1 MGQAFCCIQVDQSNVAIKEQFGKFDEVLEPGCHCLPWCFGSQLAGHLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_010459268.1| PREDICTED: hypersensitive-induced response protein 1-like [Camelina sativa] Length = 288 Score = 97.4 bits (241), Expect = 3e-20 Identities = 45/63 (71%), Positives = 49/63 (77%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M LCC+ V AI+E+FGKF DVLEPGCHFLPWC G +AGYLSLRVQQLDV CET Sbjct: 1 MGNLLCCVQVDQSTVAIKETFGKFEDVLEPGCHFLPWCLGSQVAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >gb|KDO82770.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82771.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82772.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82773.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82774.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82775.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82776.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82777.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82778.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82779.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82780.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] gb|KDO82781.1| hypothetical protein CISIN_1g0229932mg, partial [Citrus sinensis] Length = 63 Score = 91.3 bits (225), Expect = 3e-20 Identities = 44/63 (69%), Positives = 49/63 (77%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QAL C+ V AI+E+FGKF+DVLEPGCH LPWC G +AG LSLRVQQLDV CET Sbjct: 1 MGQALGCIQVDQSTVAIKETFGKFDDVLEPGCHCLPWCLGSQVAGQLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_020098132.1| hypersensitive-induced response protein 1-like [Ananas comosus] ref|XP_020098133.1| hypersensitive-induced response protein 1-like [Ananas comosus] ref|XP_020098134.1| hypersensitive-induced response protein 1-like [Ananas comosus] ref|XP_020098135.1| hypersensitive-induced response protein 1-like [Ananas comosus] Length = 285 Score = 97.1 bits (240), Expect = 4e-20 Identities = 44/63 (69%), Positives = 51/63 (80%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QA CC+ V AI+E+FG+F++VLEPGCH LPWC G+ IAGYLSLRVQQLDV CET Sbjct: 1 MGQAFCCIQVDQSTVAIKETFGRFDEVLEPGCHLLPWCLGKQIAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_009410754.1| PREDICTED: hypersensitive-induced response protein 1 [Musa acuminata subsp. malaccensis] ref|XP_018684918.1| PREDICTED: hypersensitive-induced response protein 1 [Musa acuminata subsp. malaccensis] Length = 285 Score = 97.1 bits (240), Expect = 4e-20 Identities = 45/63 (71%), Positives = 51/63 (80%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QAL C+ V A+ E+FGKF+++LEPGCHFLPWC GR IAGYLSLRVQQLDV CET Sbjct: 1 MGQALGCVQVDQSTVAVRETFGKFDEILEPGCHFLPWCIGRQIAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >ref|XP_018485848.1| PREDICTED: hypersensitive-induced response protein 1 [Raphanus sativus] ref|XP_018485849.1| PREDICTED: hypersensitive-induced response protein 1 [Raphanus sativus] ref|XP_018485850.1| PREDICTED: hypersensitive-induced response protein 1 [Raphanus sativus] ref|XP_018485869.1| PREDICTED: hypersensitive-induced response protein 1 [Raphanus sativus] ref|XP_018485870.1| PREDICTED: hypersensitive-induced response protein 1 [Raphanus sativus] ref|XP_018485871.1| PREDICTED: hypersensitive-induced response protein 1 [Raphanus sativus] Length = 287 Score = 97.1 bits (240), Expect = 4e-20 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M LCC+ V AI+E+FGKF DVLEPGCHFLPWC G+ +AGYLSLR+QQLDV CET Sbjct: 1 MGNLLCCVQVDQSTVAIKETFGKFEDVLEPGCHFLPWCLGQQVAGYLSLRLQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >emb|CBI32018.3| unnamed protein product, partial [Vitis vinifera] Length = 373 Score = 97.8 bits (242), Expect = 7e-20 Identities = 45/63 (71%), Positives = 51/63 (80%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCL-----NVAIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QA CC+ NVAI+E FGKF++VLEPGCH LPWCFG +AG+LSLRVQQLDV CET Sbjct: 88 MGQAFCCIQVDQSNVAIKEQFGKFDEVLEPGCHCLPWCFGSQLAGHLSLRVQQLDVRCET 147 Query: 373 KTK 365 KTK Sbjct: 148 KTK 150 >gb|KXG25127.2| hypothetical protein SORBI_3007G120401 [Sorghum bicolor] Length = 413 Score = 98.2 bits (243), Expect = 8e-20 Identities = 47/65 (72%), Positives = 53/65 (81%), Gaps = 5/65 (7%) Frame = -1 Query: 544 EDMRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHC 380 EDM QAL + V AI+ESFGKF+++LEPGCHFLPWC G+ IAGYLSLRVQQLDV C Sbjct: 128 EDMGQALGLVQVDQSTVAIKESFGKFDEILEPGCHFLPWCIGKQIAGYLSLRVQQLDVRC 187 Query: 379 ETKTK 365 ETKTK Sbjct: 188 ETKTK 192 >emb|CDP02195.1| unnamed protein product [Coffea canephora] Length = 290 Score = 96.3 bits (238), Expect = 9e-20 Identities = 45/63 (71%), Positives = 49/63 (77%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M LCC V AI+E+FGKF+DVLEPGCHFLPWC G IAGYLSLR+QQLDV CET Sbjct: 1 MGNLLCCAQVGQSTVAIKETFGKFDDVLEPGCHFLPWCLGSQIAGYLSLRLQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >gb|OEL13374.1| Hypersensitive-induced response protein 1 [Dichanthelium oligosanthes] Length = 293 Score = 96.3 bits (238), Expect = 9e-20 Identities = 44/63 (69%), Positives = 52/63 (82%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QAL C+ V A++ESFGKF+++L+PGCHFLPWC G+ IAGYLSLRVQQLDV CET Sbjct: 1 MGQALGCVQVDQSTVAVKESFGKFDEILQPGCHFLPWCIGKQIAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63 >gb|ONK59367.1| uncharacterized protein A4U43_C08F5710 [Asparagus officinalis] Length = 757 Score = 99.0 bits (245), Expect = 1e-19 Identities = 47/63 (74%), Positives = 52/63 (82%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M QALCCL V AI+E+FGKF+DVLEPGCH LPW FG+ +AGYLSLRVQQLDV CET Sbjct: 473 MGQALCCLQVDQSTVAIKETFGKFDDVLEPGCHCLPWIFGQQVAGYLSLRVQQLDVRCET 532 Query: 373 KTK 365 KTK Sbjct: 533 KTK 535 >dbj|GAU31395.1| hypothetical protein TSUD_370440, partial [Trifolium subterraneum] Length = 134 Score = 92.0 bits (227), Expect = 1e-19 Identities = 45/63 (71%), Positives = 48/63 (76%), Gaps = 5/63 (7%) Frame = -1 Query: 538 MRQALCCLNV-----AIEESFGKFNDVLEPGCHFLPWCFGRHIAGYLSLRVQQLDVHCET 374 M AL CL V AI E FGK+ DVLEPGCH++PWC GR IAGYLSLRVQQLDV CET Sbjct: 1 MGLALGCLQVEQSTIAIREVFGKYEDVLEPGCHWVPWCMGRQIAGYLSLRVQQLDVRCET 60 Query: 373 KTK 365 KTK Sbjct: 61 KTK 63