BLASTX nr result
ID: Ophiopogon24_contig00005521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00005521 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010918657.1| PREDICTED: uncharacterized protein LOC105042... 55 2e-07 ref|XP_008789180.1| PREDICTED: uncharacterized protein LOC103706... 54 8e-07 ref|XP_023875722.1| uncharacterized protein LOC111988176 [Quercu... 53 2e-06 ref|XP_020100259.1| uncharacterized protein LOC109718424 [Ananas... 52 2e-06 >ref|XP_010918657.1| PREDICTED: uncharacterized protein LOC105042970 [Elaeis guineensis] Length = 80 Score = 55.1 bits (131), Expect = 2e-07 Identities = 32/66 (48%), Positives = 35/66 (53%) Frame = -3 Query: 401 HKQRQGFSTFAYDGLLPPLSSEVLPKQGASLQLITKQPPSIRFIPMQAPAVPRFTWPMGL 222 HKQRQG STFAY+G LPP SSEV P Q S +WP+GL Sbjct: 33 HKQRQGISTFAYEGPLPPASSEVAPNQEKSAS---------------------NSWPIGL 71 Query: 221 ASLLKK 204 ASLLKK Sbjct: 72 ASLLKK 77 >ref|XP_008789180.1| PREDICTED: uncharacterized protein LOC103706747 [Phoenix dactylifera] Length = 80 Score = 53.5 bits (127), Expect = 8e-07 Identities = 31/66 (46%), Positives = 36/66 (54%) Frame = -3 Query: 401 HKQRQGFSTFAYDGLLPPLSSEVLPKQGASLQLITKQPPSIRFIPMQAPAVPRFTWPMGL 222 HKQRQG STFAY+G LPP+SS+V KQ S +WP+GL Sbjct: 33 HKQRQGISTFAYEGPLPPVSSDVTSKQETS---------------------ATNSWPIGL 71 Query: 221 ASLLKK 204 ASLLKK Sbjct: 72 ASLLKK 77 >ref|XP_023875722.1| uncharacterized protein LOC111988176 [Quercus suber] ref|XP_023875724.1| uncharacterized protein LOC111988176 [Quercus suber] ref|XP_023875725.1| uncharacterized protein LOC111988176 [Quercus suber] Length = 99 Score = 53.1 bits (126), Expect = 2e-06 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = -3 Query: 401 HKQRQGFSTFAYDGLLPPLSSEVLPKQGASLQLIT--KQPPSIRFIPMQAPAVPRFTWPM 228 HKQRQG STFAY+G PP+ SE A L++I ++P +P + RF W Sbjct: 33 HKQRQGMSTFAYEGATPPICSET----SAKLEIIPVHQRPGLASILPKKLEPSIRFGWSA 88 Query: 227 GLASLLKKFV 198 GLAS+L K V Sbjct: 89 GLASILFKKV 98 >ref|XP_020100259.1| uncharacterized protein LOC109718424 [Ananas comosus] gb|OAY83548.1| 50S ribosomal protein L36 [Ananas comosus] Length = 79 Score = 52.4 bits (124), Expect = 2e-06 Identities = 29/66 (43%), Positives = 36/66 (54%) Frame = -3 Query: 401 HKQRQGFSTFAYDGLLPPLSSEVLPKQGASLQLITKQPPSIRFIPMQAPAVPRFTWPMGL 222 HKQRQG STFAY+G LPP+SSEV K+ ++ WP+GL Sbjct: 33 HKQRQGISTFAYEGPLPPVSSEVSKKETST----------------------SINWPIGL 70 Query: 221 ASLLKK 204 AS+LKK Sbjct: 71 ASILKK 76