BLASTX nr result
ID: Ophiopogon24_contig00005245
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00005245 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59315.1| uncharacterized protein A4U43_C08F5180 [Asparagus... 58 2e-07 ref|XP_020277264.1| LOW QUALITY PROTEIN: V-type proton ATPase su... 58 3e-07 gb|ONK76601.1| uncharacterized protein A4U43_C03F30000 [Asparagu... 54 1e-06 ref|XP_004977299.1| V-type proton ATPase subunit C [Setaria ital... 55 4e-06 ref|XP_010939209.1| PREDICTED: V-type proton ATPase subunit C is... 54 5e-06 ref|XP_020259223.1| V-type proton ATPase subunit C [Asparagus of... 54 8e-06 ref|XP_020080673.1| V-type proton ATPase subunit C-like [Ananas ... 54 8e-06 gb|PAN16157.1| hypothetical protein PAHAL_C00528 [Panicum hallii] 54 8e-06 >gb|ONK59315.1| uncharacterized protein A4U43_C08F5180 [Asparagus officinalis] Length = 260 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 369 YWKSEEDVSIAGLGGDAEDYPYVSFTINIT 280 YWKSEED +IAGLGG+ E YPYVSFTINIT Sbjct: 231 YWKSEEDANIAGLGGETEAYPYVSFTINIT 260 >ref|XP_020277264.1| LOW QUALITY PROTEIN: V-type proton ATPase subunit C-like [Asparagus officinalis] Length = 374 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 369 YWKSEEDVSIAGLGGDAEDYPYVSFTINIT 280 YWKSEED +IAGLGG+ E YPYVSFTINIT Sbjct: 345 YWKSEEDANIAGLGGETEAYPYVSFTINIT 374 >gb|ONK76601.1| uncharacterized protein A4U43_C03F30000 [Asparagus officinalis] Length = 131 Score = 53.9 bits (128), Expect = 1e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -1 Query: 369 YWKSEEDVSIAGLGGDAEDYPYVSFTINIT 280 YWKSEEDV +A LGG+++ YPYV+FTINIT Sbjct: 102 YWKSEEDVGLAALGGESDAYPYVTFTINIT 131 >ref|XP_004977299.1| V-type proton ATPase subunit C [Setaria italica] gb|KQK99566.1| hypothetical protein SETIT_010360mg [Setaria italica] Length = 377 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 369 YWKSEEDVSIAGLGGDAEDYPYVSFTINI 283 YWKSE+DVS+AGLGG++E +PYVSFTINI Sbjct: 348 YWKSEDDVSVAGLGGESELHPYVSFTINI 376 >ref|XP_010939209.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Elaeis guineensis] Length = 374 Score = 54.3 bits (129), Expect = 5e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -1 Query: 369 YWKSEEDVSIAGLGGDAEDYPYVSFTINI 283 +WKSE++VS+AG+GG+AE YPYVSFTINI Sbjct: 345 FWKSEDEVSLAGIGGEAEAYPYVSFTINI 373 >ref|XP_020259223.1| V-type proton ATPase subunit C [Asparagus officinalis] Length = 374 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -1 Query: 369 YWKSEEDVSIAGLGGDAEDYPYVSFTINIT 280 YWKSEEDV +A LGG+++ YPYV+FTINIT Sbjct: 345 YWKSEEDVGLAALGGESDAYPYVTFTINIT 374 >ref|XP_020080673.1| V-type proton ATPase subunit C-like [Ananas comosus] ref|XP_020096678.1| V-type proton ATPase subunit C-like [Ananas comosus] gb|OAY72834.1| V-type proton ATPase subunit C [Ananas comosus] Length = 374 Score = 53.9 bits (128), Expect = 8e-06 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -1 Query: 369 YWKSEEDVSIAGLGGDAEDYPYVSFTINI 283 YWKSE+DV IAG+GG+AE YPYVSFTI++ Sbjct: 345 YWKSEDDVGIAGMGGEAEAYPYVSFTISL 373 >gb|PAN16157.1| hypothetical protein PAHAL_C00528 [Panicum hallii] Length = 377 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = -1 Query: 369 YWKSEEDVSIAGLGGDAEDYPYVSFTIN 286 YWKSE+DVSIAGLGG++E +PYVSFTIN Sbjct: 348 YWKSEDDVSIAGLGGESEVHPYVSFTIN 375